KEGG   Methylobacterium nodulans: Mnod_2680Help
Entry
Mnod_2680         CDS       T00839                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mno  Methylobacterium nodulans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mnod_2680
   01230 Biosynthesis of amino acids
    Mnod_2680
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mnod_2680
  Energy metabolism
   00680 Methane metabolism
    Mnod_2680
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mnod_2680
Enzymes [BR:mno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mnod_2680
Exosome [BR:mno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mnod_2680
  Exosomal proteins of melanoma cells
   Mnod_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2752660..2753301)
Genome map
AA seq 213 aa AA seqDB search
MDIGKQMLVLMRHGQSLDNEQDLFSGWRNPALTARGVAEAHAAGRKLKELGFSFNLAFTS
KLRRAQHTLALMLEELGQPTLPVHADTALNERDYGALSGLNKTGARSLWGAEQVHLWRKS
YDAVPPGGESLAMTAARVVPFYEREIAPCARAGKRVLVVAHGNSLRSLVMHLDGLDPEEI
VGVNIATSEILIYCLNKRGHIASKTAMPASSIA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggatataggcaagcagatgctcgtgctgatgcgccatgggcagagcctggacaacgaa
caggacctgttctcagggtggcgcaacccggccttgactgcccgcggtgttgccgaggct
cacgcagctgggcgcaagctgaaagaactcggcttttccttcaatcttgcattcaccagc
aagctcaggcgcgctcagcacacgctggccctcatgcttgaggaactcggccagcccacc
ctccccgtgcatgcagacacggctctgaacgagcgtgactacggcgcgctcagcggcttg
aacaagacgggcgctcgttcgctctggggtgcggagcaggtccatctctggcgcaagtcc
tacgacgcagtgccaccgggtggcgagagtttggcaatgacggctgcgcgcgtcgtgccc
ttctacgaacgcgagatcgcgccttgcgcccgagcgggcaagcgggtgcttgtggtcgcg
cacggtaacagcctgcgttctctggttatgcatctggatggactcgatcctgaagagata
gtcggggtgaacatcgctacgagcgagatcctgatttactgcttgaataagcggggccat
atcgccagtaaaacagccatgcctgcatcatccattgcttag

DBGET integrated database retrieval system