KEGG   Methylobacterium nodulans: Mnod_2863Help
Entry
Mnod_2863         CDS       T00839                                 

Definition
(RefSeq) NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase
  KO
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
mno  Methylobacterium nodulans
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mnod_2863
   01230 Biosynthesis of amino acids
    Mnod_2863
  Energy metabolism
   00680 Methane metabolism
    Mnod_2863
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mnod_2863
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Mnod_2863
Exosome [BR:mno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mnod_2863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2943489..2944733
Genome map
AA seq 414 aa AA seqDB search
MTNRLSLPKDKIRVLLLEGINDSAVMLLNAAGYTNVTRLSKALGPTDLHEALKGTHILGI
RSRTQLDEAALEAADRLIAVGCFSVGTNQVDLEAARRRGIPIFNAPFSNTRSVAELVIGE
IVMLLRRIVPRSVSAHAGGWDKSAANSFEVRGKTLGIVGYGNIGSQLSNLAEAMGMRVIF
FDLTDRLRHGNTEPVDTLEELLAQSDVVSLHVPETPATHTMIGEAQIRAMKPGAYLINNS
RGTVVDLEALASALRDGHLRGAAVDVFPVEPKSNHERFTSPLQGLENVILTPHVGGSTEE
AQERIGSEVARKLVDYSDIGSTVGAVNFPQVQLAARPLGTRYIHVQRNIPGMLRRLNDVF
ASNGINIAAQFYQTDGEVGYVVIETDALGDADALLEEIRELEGTIRARLLYERR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacagactttcgctcccgaaggacaagatccgcgtccttctcctcgaaggaatc
aacgacagtgcggtgatgctgctgaacgcggcgggctacaccaacgtcacgcggctctcg
aaggccctcggtcccaccgacctgcacgaggcgctcaagggcacgcatatcctgggcatc
cgctcgcgcacgcagctcgacgaggcggccctcgaggcggccgaccgcctgatcgccgtc
gggtgcttctcggtcggcaccaaccaggtggatctcgaagcggcccgccgccggggcatc
cctatcttcaacgcgcccttctccaacacccggtcggtcgccgaactggtcatcggcgag
atcgtgatgctgctgcgccgcatcgtgccgcgctccgtctccgcccatgcgggcggctgg
gacaagtcggcggcgaactccttcgaggtgcgcggcaagacgctcggcatcgtcggctac
ggcaatatcggctcgcagctttcgaacctcgccgaggcgatgggcatgcgggtgatcttc
ttcgacctgaccgaccgcctgcgccacggcaacaccgagccggtggacaccctggaggag
cttctggcccagagcgacgtcgtgtcgctgcacgtgccggagacgcccgccacccacacc
atgatcggcgaggcgcagatccgggcgatgaagcccggcgcctacctcatcaacaacagc
cgcggcacggtggtggacctcgaggcgctggcgagcgcgctgcgcgacggccacctgcgc
ggcgccgccgtggacgtcttcccggtcgagccgaagtcgaaccacgagcgcttcacctcg
ccgctccaggggctggagaacgtaatcctcaccccgcatgtcggcggctcgacggaggag
gcgcaggagcgcatcggctccgaggtggcgcgcaagctcgtcgactattcggatatcggc
tcgacggtgggcgcggtgaacttcccgcaggtgcagctcgcagcccgtccgctcggcacc
cgctacatccacgtccagcgcaacattcccggcatgctgcgccggctcaacgacgtcttc
gccagcaacggcatcaacatcgcggcccagttctatcagacggatggcgaggtcggttac
gtcgtcatcgagacggacgcgttgggcgacgccgatgcgctgctggaggagatccgggaa
ctcgaaggcacgatccgggcgcggctgctgtacgagcggcggtag

DBGET integrated database retrieval system