KEGG   Methylobacterium nodulans: Mnod_3128Help
Entry
Mnod_3128         CDS       T00839                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mno  Methylobacterium nodulans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mnod_3128
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mnod_3128
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mnod_3128
Enzymes [BR:mno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mnod_3128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3227566..3228693)
Genome map
AA seq 375 aa AA seqDB search
MTPPSYIDPRTGKLYPLDVPRWCSDDRTPLLVTPGPGISRDDIESRTRSLWRYRAALPVD
IADPITMGEGCTPLVQRPWGDLRPFFKLEWFNPTGSFKDRGSSVMLSFLRQIGVDAVLED
SSGNGGSSMAGFGAAGGVRVKILAPAYTSPAKIAQVRAYGAEVQLVEGPREESEAEAIRQ
SGQTFYASHNWQPFFLEGTKSLAYELWEDFGFKVPDNIIIPVGAGSSLLGCAFGFRELMK
AGQITKLPRLFVAQPLNCSPIDASFQAGVDTPLTREVHKTIAEGTAIKHPLRLREIIAAL
RESGGGTIALTEEEIIAALRRLARQGLFAEPTCASAAAALDTLSSAGSIKAGESTVVIVT
GTGLKAASTVADVVQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgacacctcccagctacatcgatccccgaaccgggaagctctacccgctggacgtgccc
cgctggtgctcggacgatcgcactcccctgctcgtcacgcctggacccggcatctcccgc
gacgacatcgagagccgcacccgctcgctctggcgctatcgcgcagcactgcccgtcgac
atcgccgacccgatcaccatgggcgagggttgcacgccgctggtccaacggccctggggc
gacctgcgcccgttcttcaagctggagtggttcaacccgaccggcagcttcaaggatcgg
ggcagctcggtgatgttgtccttccttcggcagatcggcgtcgatgccgtgctggaggac
agctcgggcaatggcggctcgtcgatggcaggcttcggcgccgccggtggtgtgcgggtg
aagatcctggccccggcttacacctctccagccaagatcgcccaggtgcgcgcctacggc
gccgaggtgcagctcgttgaaggaccgcgtgaggagtccgaagccgaggccattcggcag
tcgggccaaaccttctatgccagccacaactggcagcccttcttcctggagggcacgaaa
tccctcgcctacgagctgtgggaggatttcggcttcaaggtccccgacaacatcatcatc
ccggtcggggccggcagcagcctgctcggctgcgcctttggcttccgcgagctgatgaag
gccggacagatcacgaagctgccgcgcctattcgtggctcagccgctgaactgctcgccc
attgacgcgagctttcaggccggcgtcgacacgcccctgacccgcgaagtgcacaagacc
atcgcggagggcacggcgatcaagcatcccctgcggctgcgagagatcatcgcggctctg
cgcgagagcggcggtggcaccatcgcgctgaccgaggaggagatcatcgctgcgctgcgc
cggcttgcccggcagggcctgttcgccgagcccacctgtgcgagcgcggccgccgcgctc
gacacgctgtccagcgccggcagcatcaaggcgggcgagagcaccgtggtgatcgtcacc
ggcaccggcctgaaggccgcgtccaccgtcgccgacgtggtgcaatag

DBGET integrated database retrieval system