KEGG   Methylobacterium nodulans: Mnod_3310Help
Entry
Mnod_3310         CDS       T00839                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mno  Methylobacterium nodulans
Pathway
mno00240  Pyrimidine metabolism
mno00250  Alanine, aspartate and glutamate metabolism
mno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mnod_3310
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mnod_3310
Enzymes [BR:mno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mnod_3310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACL58233
JGI: Mnod3310
UniProt: B8IL45
Position
3420046..3420996
Genome map
AA seq 316 aa AA seqDB search
MSTQPTRPGFPHRHLLGIEGLTPLDIAALLDRADEAVEISRQVEKKRTTLRGRTQINLFF
EPSTRTQSSFELAGKRLGADVMNMSVASSSVKKGETLIDTAATLNAMRPDIIVVRHHQAG
AVHLLARKVDCAVVNAGDGAHEHPTQALLDALTIRRNKGRIEGLQVAICGDVLHSRVARS
NIILLQALGARVRVIGPSTLLPPGIERMGVEVFTDMRAGLRDSDIVMMLRLQRERMNGSF
VPSVKEYFRYFGLDGEKLRLAKPDALVMHPGPMNRGVEISSEVADGAQSLIKEQVEMGVA
VRMAVLEALAMHLPNA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccagccgacccgcccgggcttcccgcaccgccacctgctcggcatcgagggc
ctgacgcccctcgacatcgccgcgctgctcgaccgcgccgacgaggccgtcgagatcagc
cggcaggtggagaagaagcgcacgacgctgcgcggccgcacgcagatcaacctgttcttc
gagccctcgacccgcacccaatcctccttcgagctcgcgggcaagcggctcggggccgac
gtgatgaacatgtcggtcgcctcctcgtcggtgaagaagggcgagacgctgatcgacacc
gccgcgacgctgaacgccatgcggcccgacatcatcgtggtgcgccaccatcaggcgggc
gccgtgcatctcctggcccgcaaggtcgattgcgcggtggtgaatgcgggcgatggcgcc
cacgagcacccgacccaggccctcctcgacgcgctcaccatccgccgcaacaagggccgg
atcgaggggctccaggtggcgatctgcggcgacgtcctgcattcgcgggtggcgcgctcg
aacatcatcctgctccaggcgctcggtgcccgggtgcgggtcatcggcccctcgacgctg
ctgccgccgggcatcgagcgcatgggcgtcgaggtcttcaccgacatgcgggcgggcctg
cgcgactccgacatcgtcatgatgctgcgccttcagcgcgagcgcatgaacggctccttc
gtgccctccgtgaaagagtatttccgctatttcggcctcgacggcgagaagctgaggctc
gccaagcccgacgcgctcgtgatgcatccgggccccatgaaccggggcgtcgagatctcg
tccgaggtcgcggacggggcgcagtcgctgatcaaggaacaggtggagatgggcgtggcg
gtgcgcatggcggtgctggaggcgctggcgatgcacctgccgaacgcctga

DBGET integrated database retrieval system