KEGG   Methylobacterium nodulans: Mnod_3324Help
Entry
Mnod_3324         CDS       T00839                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mno  Methylobacterium nodulans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3433277..3434338
Genome map
AA seq 353 aa AA seqDB search
MSDLSRADTDRSLAVGQRAIELMKAYGSSASPRSYAVWYTYVSGHQPLLNEAVKRIAAEH
GALRDDTIEVLYDTYLDSRRQVVETERAGTTLLSEMEQVLEMLDVALGSTARYGASLQAF
SQDIVAPTVNRARLRDLVASLIVATRDVTADNRTLEARMRESREEIRSLHEMLEAVRVES
LTDPLTGIGNRKLFEEVLHKAVGDAVANRQSIALIVLDIDHFKRFNDVYGHLTGDRVLRL
VALTMREMVDSRATIARFGGEEFGVIVPYGGRDDALDLAERIRTSVMGRELVKRSSGESL
GRVTVSVGVAAYRAGDTAVSLIERADQCMFAAKRSGRNRVVVDESGLDVTQVA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctgtccagggccgacacggaccgcagcctcgcggtcggccaacgggcgatc
gagctgatgaaggcctatgggtcgtcggcgagcccgcgcagctatgctgtctggtacacc
tacgtgtcggggcatcagcctctgctcaacgaggcggtgaagcgaatcgcggccgagcac
ggcgcgctgcgcgacgacacgatcgaggttctctacgacacctatctcgacagccgccgc
caggtcgtggagaccgagcgggcgggcaccaccctgctctccgagatggagcaggtgctg
gagatgctggatgtcgcactcggctcgacggcccgctacggggcctcgctccaggccttc
agccaagacatcgtcgccccgacggtcaaccgggcgcggctgcgcgatctcgtggcgtcg
ctgatcgtggcgacgcgggacgtcaccgccgacaaccgcaccctcgaggcgcggatgcgg
gagagccgcgaggagatccggagcctgcacgagatgctggaggccgtccgggtcgagtcc
ctcaccgatccgctcaccgggatcggcaaccgcaagctgttcgaggaggtgctgcacaag
gcggtcggcgacgccgtcgcgaaccggcagtccatcgcgctcatcgttctcgacatcgac
cacttcaagcggttcaacgacgtctatggccatctcaccggagaccgcgtgctgcgcctc
gtcgcgctgacaatgcgcgagatggtcgattcgcgcgccaccatcgcccgcttcggcggc
gaggagttcggggtcatcgtgccctatggcgggcgggacgatgcgctcgatctggcggag
cggatccgcacgagcgtgatgggccgcgagctcgtcaagcggtcgagcggcgagtcgctc
ggccgcgtcacggtctcggtcggtgtcgccgcctatcgggccggcgacaccgctgtttcg
ctgatcgagcgtgcagatcagtgcatgttcgcggccaagcgctccggccgcaaccgcgtc
gtcgtggacgaatccggactggacgtcacgcaggtcgcctga

DBGET integrated database retrieval system