KEGG   Methylobacterium nodulans: Mnod_3739Help
Entry
Mnod_3739         CDS       T00839                                 

Definition
(GenBank) glycoside hydrolase family 8 (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
mno  Methylobacterium nodulans
Brite
Enzymes [BR:mno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mnod_3739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3843183..3844589)
Genome map
AA seq 468 aa AA seqDB search
MRSPLHPIRPAAQQAKRWHATASLLRLLVCRRFLLENRKALFRNLLRAVPVSAETGTAPK
SLMFRAPLRRTGIHFGGERSGRSRCGRLVGIALVAVGITMQAPRAQQPEATTVPPATALP
SSPRQDGRATAAAGPTLAGSLADPAAWRLYRSQFVTEQGRIIDSANDRISHSEGQGYGML
LAVAANDRASFERIWGWTRANLMVRPDALMAWRWAPDKRPAVADLNNASDGDILVAWALT
EAAEAWGEPSYRTAARRIAVEFGRKAILFKDPHGPLILPAVSGFSAQDRSDGPLVNLSYW
VFPAFQRLPIVAPEYDWAAVIRSGLGLVRQARFGPSSLPTEWISAKADVVRPADGFPTLF
SYNAIRVPLYLAWAAVGQPEDVAPFRRLWGGIEGERLPIVDTSDGRPAEWLTEPGYGALP
ALVACAVDNTPWPESLETVQPNQNYYPTTLHLLSLITVRMRYPSCLKR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgccgctgcatccgatccggccggcggctcagcaggcgaagcggtggcacgcc
accgcaagcctgctgaggctcttggtatgccgcaggtttttgctggaaaaccgcaaggca
cttttccgaaacctgcttagagccgtgcccgtttcggctgaaacgggcacggctcccaag
tctctaatgtttcgcgctcccttacgccgaaccggcatccacttcggcggggagcgctct
ggacggagccggtgcggccgcctcgtcgggattgcgctcgtggccgttgggatcacgatg
caggccccccgtgcccaacagccggaggccacgaccgtgccgcccgcgaccgcgcttccg
agttccccccgccaggatggccgcgcgacggcagcggccggccccaccctcgccgggagc
ctcgccgatccggcggcctggcgcctctaccgcagccagttcgtgaccgagcagggccgc
atcatcgattccgccaacgatcggatcagccacagcgagggccagggctacgggatgctg
ctcgcggtcgcggccaatgatcgggcgagcttcgagcgcatctggggctggacgcgcgcc
aacctgatggtgcggccggatgcgctgatggcgtggcgctgggcgcccgacaagcgcccg
gcggtagcggacctcaataacgcgagcgacggcgacatcctggtggcctgggcgctcacc
gaggccgccgaggcctggggtgagccctcctaccgcacggcggcgcgccgcatcgccgtc
gagttcggccggaaggcgatcctgttcaaggatccgcacgggccgctgatcctgcccgcc
gtctcgggcttctccgcgcaggaccggtccgacggtccgctcgtcaacctctcctactgg
gtgtttcccgccttccagcgcctgccgatcgtcgcgcccgaatacgactgggccgcggtg
atccgcagcggcctcggactggtgcgccaagcccgcttcgggccgagcagcctcccgacc
gagtggatctccgcgaaggcggatgtggtgcgccccgccgacggcttcccgaccctcttt
tcctacaatgccatccgggttcctctctacctggcctgggccgccgtcgggcagcccgag
gatgtcgcgcccttccgcaggctctggggcgggatcgagggggagcgcctgccgatcgtc
gacacgagcgacggtaggccggcggaatggctgaccgaaccgggctacggcgccctgccg
gccctggtggcctgcgcggtcgacaacacgccatggccggagagcctggagaccgtgcag
cccaatcagaactactacccgaccactttgcacctgctcagcctgatcacggtgcgaatg
cgctatccgtcatgcctcaagcgctga

DBGET integrated database retrieval system