KEGG   Methylobacterium nodulans: Mnod_3983Help
Entry
Mnod_3983         CDS       T00839                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mno  Methylobacterium nodulans
Pathway
mno00010  Glycolysis / Gluconeogenesis
mno00620  Pyruvate metabolism
mno00640  Propanoate metabolism
mno00680  Methane metabolism
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
mno01130  Biosynthesis of antibiotics
mno01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mnod_3983
   00620 Pyruvate metabolism
    Mnod_3983
   00640 Propanoate metabolism
    Mnod_3983
  Energy metabolism
   00680 Methane metabolism
    Mnod_3983
Enzymes [BR:mno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mnod_3983
Lipid biosynthesis proteins [BR:mno01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mnod_3983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACL58871
JGI: Mnod3983
UniProt: B8ITF5
Position
complement(4056851..4058524)
Genome map
AA seq 557 aa AA seqDB search
MSLQQSGPGLSRIRELISLYADPKVSVAEVLCDRYTQDALAYKVVGSDLEATNLTYGDLR
VRSERFASALAGLGVGPGDRVATLMGKSVEYLVTLLAIWRLGAVHVPIFTAFAPPAIAFR
LLGSRAKVIVCDAAQQPKLAPGQDIPADAHWKVVTTAGPEQDVQGALRFADLVASSSPGM
PAARLGGDAPIIEIYTSGTTGRPKGVVVPTRALAGFRAYAEFGLGIRADDLYWCAADPGW
AYGLYFGILGSLSTGVPSLLYGSGFDAGATLEILSRYGVTNFTAAPTVYRSLRVYSGPIP
KITKLRCASSAGEPLTPDVNLWAGDALGVAVHDHYGQTEAGMLINNHHHPDLRQPLKPGS
MGRPLPGWSMLVLKDQEDAPAADGELGRVAVELSESPLAWFSGYIDDPQKSAEKFAGNGR
WYLTGDAGRRDEDGYYHFASRDDDVIIMAGYRIGPFEIESIIVTHPAVSECAVIAVPDET
RGEVLEAYVVLRSGEQASPEIVREIQSWVKTRYAAHAFPRKVHFTEALPKTASGKVQRFV
LRQQRRAELASQVPEAV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcagcagagcgggcctggcctgtcacgcatcagagaactcatctctttatat
gcagatcccaaggtgagcgtggcggaagtcctttgcgaccgctacacgcaggacgccttg
gcgtacaaggtggtgggctctgatcttgaagccaccaacctcacctacggagacctgcgc
gtccggtccgagcggttcgcttccgcgctagccggtctcggtgttggacctggcgatcgc
gtcgccaccttgatgggcaagagcgtcgagtatctcgttaccctgctggccatctggcgc
ctcggtgcggtccacgtcccaatcttcaccgcgttcgcgccgcccgccatcgccttccgg
ctcctcggcagcagagcaaaggtaattgtgtgcgatgcggcccagcagccgaagcttgcg
ccaggccaggacatccccgctgacgcccattggaaagtggtgaccactgccgggccggaa
caagatgttcagggcgcgctgcggttcgcggacctcgtcgcttcgagttccccgggcatg
cccgccgcgaggcttggcggcgacgcaccaatcatcgagatctacacatcgggtacgact
ggacggcccaagggcgtcgtcgtcccgacacgggctcttgccggcttcagagcctatgcc
gaattcgggcttggtatacgagccgacgatctctactggtgcgccgccgatcctggttgg
gcctatggtctctatttcggaattcttggatccttatcaacgggtgttccaagcttgctg
tatggatccggctttgacgcgggcgcgacgcttgagatcctgtcgcgctatggcgtcacg
aacttcactgcggcacccacggtctaccgttccctgcgcgtctattcgggcccaatcccg
aagatcacaaagcttcgctgtgcgtccagcgccggcgagcctctgactcctgacgtaaat
ctctgggcgggcgacgcgctgggagtggcagttcacgaccactacggccagaccgaagcg
gggatgctgatcaacaatcaccatcaccccgatctccggcagcctctgaagcctggttcc
atggggcggccgcttcccggctggtcgatgctggtcctgaaggatcaggaggacgctccg
gcggcggacggtgagctcgggcgcgtggcggtggagttgagcgagagccctctcgcctgg
ttctcaggatacatcgacgatccgcagaagagtgcagagaagttcgccggcaacggccgc
tggtacctgacgggcgacgcaggccgccgggatgaggatgggtattaccacttcgcatcg
cgcgacgatgacgtgatcatcatggcgggctaccgcatcgggccgttcgagatcgagtcg
atcatcgtgactcatcccgcagtcagcgagtgcgccgtgatcgcggtaccggacgagacc
cgcggcgaagtcctggaagcctacgtcgtactccgttcgggcgagcaggcgtctccagag
atcgtccgcgagatccagagctgggtgaagacccgctacgccgcacatgccttcccaagg
aaggtgcatttcaccgaggcgctgcccaagacggcgagcggcaaggtgcagcgctttgtc
ctccgccagcagcgacgggccgaactggcatcccaggttcctgaggcggtttga

DBGET integrated database retrieval system