KEGG   Methylobacterium nodulans: Mnod_4379Help
Entry
Mnod_4379         CDS       T00839                                 

Definition
(GenBank) GHMP kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mno  Methylobacterium nodulans
Pathway
mno00900  Terpenoid backbone biosynthesis
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mnod_4379
Enzymes [BR:mno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mnod_4379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACL59250
JGI: Mnod4379
UniProt: B8IBJ6
Position
complement(4426804..4427703)
Genome map
AA seq 299 aa AA seqDB search
MTQVFSVSPLTTRAPAKINLTLHVLGRRAGDGYHALESLVVFAGVGDTLSLEPGPDLALA
VSGPTAGPAGPTADNLVLRAATRLAGLVPGLAVGRFSLVKRLPVAAGIGGGSSDAAAALR
LLARLNGLSLAHPALAEAARATGADVPVCLEPRARMMRGAGEAIGPALSLPSLPAVLINP
GVPVETAPVFRALGLAVGEANPAAAVPHPEIAAGLAPEDLLCRIGPARNDLEAPALTVAP
VIGDTLSALRDQPGCRLARMSGSGATVFGLFTHRWRAAQAARAIAARHPGWWVRATMLR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaggtgttttcggtgtctcccctcaccacccgcgctcccgccaagatcaacctg
accctgcacgtgctcggccgccgggccggggacggctatcacgccctggagagtctcgtg
gtgttcgcgggcgtcggcgacacgctgagcctggagcccgggcccgacctcgcgctcgcc
gtctcgggtccgacggcgggaccggcggggcccaccgccgacaacctcgtgctacgcgca
gcgacccggctcgcgggtctcgttccggggcttgcggtcgggcggttttcgctcgtgaag
cgtctgccggtggcggccggcatcgggggcggatcgtcggatgcggcggcggctttgcgc
ctgctcgcgcgcctcaacgggctttccctcgctcatccggcgctcgccgaggcggcccgc
gccaccggggccgatgtcccggtctgtctcgagccgcgggccaggatgatgcgcggggcg
ggcgaggcgatcgggccggcgctctccctgccgagcctgcccgcggtgctgatcaacccc
ggcgtgccggtcgagaccgcgccggtcttccgggcgctcggccttgcggtcggcgaggcg
aatccggcggccgcggtgccgcatcccgagattgccgcggggctcgcccccgaggacctc
ctctgccggatcggtcccgcccgcaacgacctcgaagccccggcgctcacggtggcgccc
gtcatcggcgacacgcttagcgcgctgcgcgaccagccgggctgccggctcgcccgcatg
tcgggctccggcgccaccgtcttcggcctgttcacgcatcgctggcgggccgcacaggcg
gcccgcgccatcgcggcccgccatccgggctggtgggtgcgcgcgacgatgctgcgctga

DBGET integrated database retrieval system