KEGG   Methylobacterium nodulans: Mnod_4416Help
Entry
Mnod_4416         CDS       T00839                                 

Definition
WecB/TagA/CpsF family glycosyl transferase
Orthology
K05946  
N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [EC:2.4.1.187]
Organism
mno  Methylobacterium nodulans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4464203..4465018)
Genome map
AA seq 271 aa AA seqDB search
MRVDLLGLPVDLLSRDETRIRALAAMRGDAAPCRHAALNVATLVGARRDGALARELRESD
IVGVDGAGIALALWLKGCGRVARVPALDLFESLVGACAREGLRPFLLGAKPDVVADAARS
LRRRHPRLVLAGLHHGYFRPDQEAELCRRIAASGADGLFVALPAPQQEGFLRRHREHLDV
PFVMSIGGAFDVVAGRVHRAPPLVRRIGAEWAYALVQEPGRLAGRTLRTNTAFAGLLLAA
ALRRLAGPAGARPTRCVRAQPAVTTTTRRRS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgacctcctcggccttccggtcgatctcctcagccgagacgaaacccgcatc
cgcgcgctggccgccatgcggggcgatgcggcgccgtgccggcatgccgcgctcaacgtc
gccacgctcgtcggcgcccggcgggacggcgcgctcgcccgcgagctgcgcgagagcgat
atcgtgggcgtcgacggcgccgggatcgcgctcgcgctctggctcaagggctgcggccgc
gtcgcgcgggttcctgccctcgacctgttcgagagcctcgttggcgcctgcgcccgcgaa
gggctgcggcccttcctgctgggcgccaagcccgacgtggtcgccgatgccgcccgcagc
ctgcgccgccgccatcctcggctggtgctcgcagggctgcatcacggctatttccggccc
gaccaggaggccgagctctgccgccggatcgccgcgagtggcgccgatgggctgttcgtg
gcgcttccggccccacagcaggagggcttcctgcggcggcaccgcgagcacctcgacgtc
cccttcgtgatgagcatcggcggcgccttcgacgtcgtcgcgggccgggtccatcgcgcc
ccgcccctcgtccggcggatcggtgcggaatgggcctatgcgctcgtccaggagcccggc
cgcctcgccggccgcacgctgcgcaccaataccgctttcgccggcctgctcctcgcggcc
gccctccgccgcctcgccggtccggcgggcgcgcgcccgacccgctgcgtccgcgcgcag
ccggctgtgaccacgaccacgaggagaagatcatga

DBGET integrated database retrieval system