KEGG   Methylobacterium nodulans: Mnod_4468Help
Entry
Mnod_4468         CDS       T00839                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mno  Methylobacterium nodulans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mnod_4468
Enzymes [BR:mno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mnod_4468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4518763..4519551
Genome map
AA seq 262 aa AA seqDB search
MGGEVSGGALRLDRTPLRVWVARPLPAGARTAALVSDLGHAPLLAPVLDLGLSHAPPPDG
VFDALILTSANAVPALESAGLIHLTAFCVGARTAQAARAAGLPDVRQGEGDAAALAGHVA
AVLPVGARLLHAAGRERKPEPAASLAAAGYAVTAWVAYAARPVASLPEPVAAALAEGRLD
AVLHYSRRSAATALGLARAAGCDEAFARLAHLCLSEDCAAPLVGAGIQSHLVAAQPTEDA
LLAALAPASPAQGGSRLDGKRC
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcgaggtgagcggcggcgcgctgaggctggatcggacgcccctgcgggtctgg
gtcgcgcggccgctgccggctggcgcacgcacggccgcgcttgtgtcggatctcggccat
gcgccgctcctcgcgcccgtgctcgatctcggccttagccacgcgccgccgccggacgga
gtgttcgacgccctgatcctgacgagtgcgaacgcggtgccggcgctggaatcggcgggc
cttatccatctcaccgccttctgcgtcggcgcccgcacggcgcaggcggcccgcgcggcc
gggctcccggatgtgcgccagggggagggtgatgcggcggcgctcgccgggcacgtcgcc
gccgtcctgccggtcggggcccgcctcctccacgcggcgggccgcgagcgcaagccggag
ccggccgcctccctcgcggccgcgggctatgcggtcacggcctgggtcgcctatgcggcg
aggccggtggcgtccctgcccgaacccgtcgcggctgccctggcagaggggcgtctcgat
gccgtcctgcactattcccgccgcagcgccgccaccgccctcgggctcgcgcgcgccgcc
ggatgcgacgaggccttcgcgcggctcgcgcatctctgcctgtccgaggattgcgccgcg
cccctggtcggcgccggcatccagtcccatctcgtcgcggcgcagccgaccgaagatgcg
ctcctcgccgccctcgctccggcctcccccgcgcaaggaggctcgcgcctggatgggaag
cggtgctaa

DBGET integrated database retrieval system