KEGG   Methylobacterium nodulans: Mnod_4468Help
Entry
Mnod_4468         CDS       T00839                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mno  Methylobacterium nodulans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mno00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4518763..4519551
Genome map
AA seq 262 aa AA seqDB search
MGGEVSGGALRLDRTPLRVWVARPLPAGARTAALVSDLGHAPLLAPVLDLGLSHAPPPDG
VFDALILTSANAVPALESAGLIHLTAFCVGARTAQAARAAGLPDVRQGEGDAAALAGHVA
AVLPVGARLLHAAGRERKPEPAASLAAAGYAVTAWVAYAARPVASLPEPVAAALAEGRLD
AVLHYSRRSAATALGLARAAGCDEAFARLAHLCLSEDCAAPLVGAGIQSHLVAAQPTEDA
LLAALAPASPAQGGSRLDGKRC
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcgaggtgagcggcggcgcgctgaggctggatcggacgcccctgcgggtctgg
gtcgcgcggccgctgccggctggcgcacgcacggccgcgcttgtgtcggatctcggccat
gcgccgctcctcgcgcccgtgctcgatctcggccttagccacgcgccgccgccggacgga
gtgttcgacgccctgatcctgacgagtgcgaacgcggtgccggcgctggaatcggcgggc
cttatccatctcaccgccttctgcgtcggcgcccgcacggcgcaggcggcccgcgcggcc
gggctcccggatgtgcgccagggggagggtgatgcggcggcgctcgccgggcacgtcgcc
gccgtcctgccggtcggggcccgcctcctccacgcggcgggccgcgagcgcaagccggag
ccggccgcctccctcgcggccgcgggctatgcggtcacggcctgggtcgcctatgcggcg
aggccggtggcgtccctgcccgaacccgtcgcggctgccctggcagaggggcgtctcgat
gccgtcctgcactattcccgccgcagcgccgccaccgccctcgggctcgcgcgcgccgcc
ggatgcgacgaggccttcgcgcggctcgcgcatctctgcctgtccgaggattgcgccgcg
cccctggtcggcgccggcatccagtcccatctcgtcgcggcgcagccgaccgaagatgcg
ctcctcgccgccctcgctccggcctcccccgcgcaaggaggctcgcgcctggatgggaag
cggtgctaa

DBGET integrated database retrieval system