KEGG   Methylobacterium nodulans: Mnod_4504Help
Entry
Mnod_4504         CDS       T00839                                 

Definition
(GenBank) Glutaminase, core
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mno  Methylobacterium nodulans
Pathway
mno00220  Arginine biosynthesis
mno00250  Alanine, aspartate and glutamate metabolism
mno00471  D-Glutamine and D-glutamate metabolism
mno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mnod_4504
   00220 Arginine biosynthesis
    Mnod_4504
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Mnod_4504
Enzymes [BR:mno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Mnod_4504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ACL59372
JGI: Mnod4504
UniProt: B8ICY0
Position
4555400..4556329
Genome map
AA seq 309 aa AA seqDB search
MPDLTSVVQEIAEEMRERPDRGEVATYIPELARADPKAFGLVVIDADGQVAAAGDSDVPF
SIQSISKVFTLTLALGMVGDRLWRRVGREPSGSPFNSIVQLEYERGIPRNPFINAGAIAV
TDLILSRHQPREALGEILRFMQFLAQDSSIAIDEAVAASELRTGFRNAALANFMKAHGVI
DNPVEYTLGVYFHHCAIAMTCRQLAEAGRFLAHSGRNPSTGHLVVQPERARRINAVMLTC
GHYDGSGEFAFRVGLPGKSGVGGGILAVAPGRASIAVWSPGLDASGNSHLGRIALERLTK
RLGWSIFGQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgccggacctgaccagtgtcgtccaggagatcgccgaggagatgcgcgagcgccccgat
cggggcgaggtcgcgacctacattcccgaactcgcccgcgccgatccgaaagccttcggt
ctggtggtgatcgatgcggatggacaggtcgcggcggccggcgacagcgacgtgcccttc
tcgattcagagcatctcgaaggtgttcaccctcacgctcgcgctcggcatggtcggcgac
cggctgtggcggcgcgtcgggcgcgagccgtcgggaagccccttcaactccatcgtccag
ctggaatacgagcgcggcattccccgcaacccgttcatcaatgccggggcgatcgccgtg
accgacctgatcctgtcgcggcaccagccccgcgaggcgctcggcgaaatcctgcgcttc
atgcaattcctggcgcaggattcctcgatcgccatcgacgaggcggtggcggcctcggag
ctgcggacgggttttcgcaatgcggcgctcgccaatttcatgaaggcgcacggggtgatc
gacaatccggtcgagtacacgctcggcgtctatttccaccattgcgccatcgcgatgacc
tgccggcaactcgccgaggccgggcggttcctcgcccattcgggccgcaacccctcgacg
gggcatctggtggtgcagccggagcgggcgcgccgcatcaacgcggtcatgctcacttgc
ggccattacgacgggtcgggcgaattcgccttccgggtcggcctgccgggcaagagcggg
gtcggcgggggcatcctggcggtcgcgccgggccgggcctccatcgccgtctggtcgcca
ggcctcgatgcctcgggcaattcccatctcgggcgcatcgccctcgaaaggcttacgaag
cggctcggctggtcgatcttcggccaatga

DBGET integrated database retrieval system