KEGG   Methylobacterium nodulans: Mnod_4583Help
Entry
Mnod_4583         CDS       T00839                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
mno  Methylobacterium nodulans
Pathway
mno01100  Metabolic pathways
mno01120  Microbial metabolism in diverse environments
mno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mnod_4583
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mnod_4583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: ACL59450
JGI: Mnod4583
UniProt: B8ID58
Position
4640688..4641044
Genome map
AA seq 118 aa AA seqDB search
MRQFILGAALALLAPLAAQAQDAAAGEKLFAQCKACHAFGKNGVGPDLKGTVGRKAGTHE
GYNYSAALKDSGLTWDEATLHKWLANPKGLVPGTKMIYAGLKDEKKVSDLIAYLKTQQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagttcatcctcggtgccgcccttgcgctcctggcgccgctcgccgcgcaggcg
caggacgctgcggcaggcgagaagctcttcgctcagtgcaaggcctgccacgccttcggc
aagaacggcgtcgggccggacctgaagggcaccgtcgggcgcaaggccgggacccatgag
ggctacaactattcggcggcgctgaaggattcgggcctgacctgggacgaggccacgctc
cacaagtggctcgccaatccgaagggtctcgtccccggcaccaagatgatctatgccggc
ctcaaggacgagaagaaggtgagcgacctgatcgcctatctgaagacccagcagtag

DBGET integrated database retrieval system