KEGG   Methylobacterium nodulans: Mnod_4583Help
Entry
Mnod_4583         CDS       T00839                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
mno  Methylobacterium nodulans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mnod_4583
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mnod_4583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4640688..4641044
Genome map
AA seq 118 aa AA seqDB search
MRQFILGAALALLAPLAAQAQDAAAGEKLFAQCKACHAFGKNGVGPDLKGTVGRKAGTHE
GYNYSAALKDSGLTWDEATLHKWLANPKGLVPGTKMIYAGLKDEKKVSDLIAYLKTQQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagttcatcctcggtgccgcccttgcgctcctggcgccgctcgccgcgcaggcg
caggacgctgcggcaggcgagaagctcttcgctcagtgcaaggcctgccacgccttcggc
aagaacggcgtcgggccggacctgaagggcaccgtcgggcgcaaggccgggacccatgag
ggctacaactattcggcggcgctgaaggattcgggcctgacctgggacgaggccacgctc
cacaagtggctcgccaatccgaagggtctcgtccccggcaccaagatgatctatgccggc
ctcaaggacgagaagaaggtgagcgacctgatcgcctatctgaagacccagcagtag

DBGET integrated database retrieval system