KEGG   Methylobacterium nodulans: Mnod_4783Help
Entry
Mnod_4783         CDS       T00839                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mno  Methylobacterium nodulans
Pathway
mno00010  Glycolysis / Gluconeogenesis
mno00620  Pyruvate metabolism
mno00640  Propanoate metabolism
mno00680  Methane metabolism
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
mno01130  Biosynthesis of antibiotics
mno01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mnod_4783
   00620 Pyruvate metabolism
    Mnod_4783
   00640 Propanoate metabolism
    Mnod_4783
  Energy metabolism
   00680 Methane metabolism
    Mnod_4783
Enzymes [BR:mno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mnod_4783
Lipid biosynthesis proteins [BR:mno01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mnod_4783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACL59647
JGI: Mnod4783
UniProt: B8IFT7
Position
4863852..4865801
Genome map
AA seq 649 aa AA seqDB search
MNHRIVAVPDAVRARAHIDEAKYKAWYDASINDPEGFWREHGKRIDWFKPYTRVKETSFG
PDNVSIRWFADGITNVAHNCIDRHLASRGDQVAIIWEGDDPADTRRITYRELHAQVGRMA
NVLRNRGVAKGDRVTIYLPMIPEAAVAMLACARLGAIHSVVFGGFSPDSLAGRIQGCASR
LIITADEGLRGGRTVPLKANVDAAIARLPADSVDHVIVVRRTGGAVAMEPGRDVYYDAAA
REVTEECPAAHVEAEHPLFLLYTSGSTGQPKGVVHTTGGYLVYAAMTHQYVFDYHEGDVY
WCTADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSVARFWEVVDKHQVSIFYTAPTAI
RSLMSAGAEPVQRTSRASLRILGSVGEPINPEAWEWYYRVVGEERCPIVDTWWQTETGGI
LISPLPGATPLKPGSATRPFFGVKPVVVDGDNRVLEGACEGNLCLDESWPGQMRTVWGDH
ARFVQTYFSTFPGRYFSGDGCRRDEDGDYWITGRVDDVINVSGHRMGTAEVESALVAHPQ
VSEAAVVGYPHSLKGQGIYAYVTLMQGVEPSEALRKELVAWVRREIGPIASPDLIQFAPG
LPKTRSGKIMRRILRKIAEDDFAALGDTSTLADPAVVDDLIENRQNRAG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatcggatcgtcgcggtgccggacgcggtgcgtgcgcgggctcacattgacgaa
gccaagtacaaggcgtggtacgacgcctcgatcaacgatccggaggggttctggcgcgag
cacggcaagcggatcgactggttcaagccctataccagggtcaaggagaccagcttcgga
cccgacaacgtctccatccgctggtttgccgacggcatcaccaacgtcgcccacaactgc
atcgaccgccacctcgccagccgcggcgaccaggtcgccatcatctgggagggcgacgat
cccgccgacacccgccgcatcacctaccgcgagctgcacgcccaggtcggccgcatggcc
aacgtcctgcgcaaccgcggcgtcgccaagggcgaccgcgtcaccatctacctgcccatg
atccccgaagccgccgtcgccatgctggcctgcgcccggctcggcgccatccattcggtg
gtgttcggcggcttctccccggattccctcgccggccgcatccagggctgcgcctcgcgc
ctgatcatcaccgccgacgagggcctgcgcggcggccgcacggtcccgctcaaggccaat
gtcgatgcggccatcgcccgcctgcccgccgacagcgtcgaccatgtcatcgtggtgcgc
cgcaccggcggcgccgtcgccatggagccggggcgcgacgtctactacgacgccgccgcc
cgcgaggtcaccgaggagtgcccggccgcccatgtcgaggccgagcatccgctcttcctg
ctctacacctccggctcgaccggccagcccaagggcgtggtccacaccaccggcggctat
ctggtctatgccgccatgacccaccagtacgtcttcgactaccacgagggcgacgtctac
tggtgcaccgccgatgtcggctgggtcaccgggcacagctacatcgtctacgggccgctc
gccaacggcgccaccaccctgatgttcgagggcatcccgacctatccgtcggtcgcccgg
ttctgggaggtggtcgacaagcaccaggtcagcatcttctacaccgccccgaccgccatc
cgctcgctgatgagcgccggcgcggagccggtgcagcggacctcgcgcgcctccctgcgc
atcctcggctcggtcggcgagccgatcaacccggaggcctgggaatggtactaccgggtg
gtcggcgaggagcgctgcccgatcgtcgacacctggtggcagaccgagaccggcggcatc
ctgatcagcccgctgcccggcgccaccccgctcaagcccggctcggccacccggccgttc
ttcggcgtcaagccggtggtggtcgacggcgacaaccgggtgctggagggtgcttgcgag
ggcaatctctgcctggacgagtcctggcccggccagatgcgcaccgtctggggcgaccat
gcgcgcttcgtgcagacctatttctcgaccttcccgggccgctacttctcgggcgacggc
tgccggcgggatgaggatggcgactactggatcaccggccgggtggacgacgtcatcaac
gtctcgggccaccggatgggcacggcggaggtcgaatccgccctggtggcgcatccgcag
gtctcggaggcggcggtggtgggctatccccacagcctcaagggccagggcatctacgcc
tacgtgacgctgatgcagggggtggagccctcggaggcgctgcgcaaggagctggtcgcc
tgggtgcgccgggagatcggcccgatcgcctcgcccgacctgatccagttcgcccccggc
ctgcccaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccgaggac
gattttgccgcgctcggcgacacctcgaccctggcggatccggcggtggtcgacgacctg
atcgagaaccggcagaaccgcgccggctga

DBGET integrated database retrieval system