KEGG   Methylobacterium nodulans: Mnod_4790Help
Entry
Mnod_4790         CDS       T00839                                 

Definition
(RefSeq) histidinol dehydrogenase (EC:1.1.1.23)
  KO
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mno  Methylobacterium nodulans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mnod_4790
  Amino acid metabolism
   00340 Histidine metabolism
    Mnod_4790
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mnod_4790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4873532..4874827
Genome map
AA seq 431 aa AA seqDB search
MLRLDSRDPAFDADFARLLSVKREVAEDVDETVRGIIAAVVERGDEALVAYTRRFDGYGA
EFTAAALRVTPEEVDAAVAAAPREALDALHLARERIETYHRAQLPADHRETDALGVTLGW
RWTALESVGLYVPGGTASYPSSVLMNAIPAKVAGVKRLAMVVPMPGGVTNPLVLAAARLA
GVDEIFRIGGAQAVAALAYGTATISPVAKIVGPGNAYVAAAKRRVFGQVGIDMIAGPSEV
LILADDSANPDWVAADLLAQAEHDPAAQAILITDSDTLAAAVAVAVEGQLSTLPRVAIAR
ASWRDYGAILRVARLADAIPLVDRLAPEHLEIEARDAEALSARVRNAGAIFLGAHTPEAI
GDYVGGPNHVLPTARSARFSSGLGVLDFMKRTSLLSCSPEALRALGPAAVALGRAEGLDG
HARSVAIRLNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctcgattcccgcgatcccgccttcgacgccgacttcgcccggctcctctcc
gtcaagcgggaggtggcggaggacgtcgacgagacggtgcgggggatcatcgccgccgtg
gtggagcggggcgacgaggcactcgtcgcgtatacccgccgcttcgacggctacggagcg
gagttcacggccgcggcgctgcgggtcacccccgaggaggtggatgccgccgtggcggcg
gccccccgggaggcgctcgacgcgctccatctcgcccgtgagcgcatcgagacataccac
cgggcgcagctgcccgccgaccaccgcgagacggacgcgctcggggtcaccctcggctgg
cgctggacggccctcgaatccgtcggcctctacgttccgggcggcaccgcgagctatccg
tcctccgtgctgatgaacgcgatccccgccaaggtcgcgggcgtgaagcggctcgccatg
gtggtgccgatgccgggcggggtcacgaacccgctggtgctcgccgcggcccgcctcgcg
ggcgtcgacgagatcttccgcatcggcggcgcgcaggccgtggccgcgctcgcctacggc
acggccaccatctcccccgtcgccaagatcgtcggccccggcaacgcctacgtggcggcg
gccaagcgccgggtgttcgggcaggtcggcatcgacatgatcgccggcccctccgaggtg
ctgatcctggccgacgacagcgccaatccggactgggtcgccgcagacctgctcgcccag
gccgagcacgatccggccgcgcaggcgatcctgatcaccgacagcgacactctcgcggcg
gccgtggcagtggccgtcgaggggcagctctccaccctgccgcgggtcgcgatcgcccgg
gcgagctggcgggattacggggcgatcctccgggtggcgcgccttgcggacgcgatcccg
ctggtcgaccggctcgccccggaacatctggagatcgaggcgcgggacgcggaggcgctg
agcgcgcgggtgcgcaatgccggcgcgatcttcctcggcgcgcacacccccgaagccatc
ggcgactatgtgggcgggcccaaccacgtgctcccgaccgcgcgctcggcccggttctcc
tcgggcctcggggtgctcgacttcatgaagcggacctcgcttctgtcctgctcccccgaa
gcgctgcgggccctcggccccgccgccgtggcgctcggtcgagcggaagggctcgacggc
cacgcccgctcggtggcgatccgtctcaacctttga

DBGET integrated database retrieval system