KEGG   Methylobacterium nodulans: Mnod_4810Help
Entry
Mnod_4810         CDS       T00839                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mno  Methylobacterium nodulans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mnod_4810
Enzymes [BR:mno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mnod_4810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4892885..4893577
Genome map
AA seq 230 aa AA seqDB search
MDERECRLRETIVELCREMNRNGLNQGTAGNISARHGDRMLLTPSATPYDRMTPAMIAAM
PLDGDGTAWEGPLKPSTEWRFHRDILRSRPDAQAVVHAHPTFATTIAITRRSIPACHYMV
AAFGGHDVRCSGYALYGTEALSREALKALEGRTACLLANHGIIAIGESLEKAMWRAVELE
ALAKQYFYSLQLEGGPVILSRAEIDEVLKGFASYGLRSDAASPERGGPAS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcgcgagtgccggctgcgggagacgatcgtcgagctgtgccgggagatgaac
cgcaatggcctgaaccagggcacggccggcaacatctccgcccgccatggcgaccggatg
ctgctgacgccgagcgccacgccctacgaccggatgacgcccgcgatgatcgcggcgatg
cccctcgacggcgatgggacggcctgggagggaccgctcaagccctccaccgagtggcgc
ttccatcgtgacatcctgcgcagccgcccggacgcccaggcagtggttcacgcccatccg
accttcgcgacgacgatcgccatcacccgccggtcgatcccggcctgtcactacatggtg
gcggcgttcggcggccacgacgtgcgctgctccggctacgcgctctatggaaccgaggcc
ctgtcgcgcgaggcgctcaaggccctggagggccgcacggcctgcctgctcgccaaccac
ggcatcatcgcgatcggcgagagcctggagaaggcgatgtggcgcgccgtcgagctcgaa
gcgctggccaagcagtatttctacagcctgcagctggaaggcgggcccgtcatcctgtcg
cgcgcggagatcgacgaggtgctgaaggggttcgccagctacgggctgcgcagcgatgcg
gcctccccggagcgcggcggcccggcctcctga

DBGET integrated database retrieval system