KEGG   Methylobacterium nodulans: Mnod_4883Help
Entry
Mnod_4883         CDS       T00839                                 

Definition
Di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mno  Methylobacterium nodulans
Brite
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Mnod_4883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4971717..4972820)
Genome map
AA seq 367 aa AA seqDB search
MRCTCSLRWAAFSLAAAIMVGVLPSGGQGPEVAADLRRAYSGPPENWPAPWIEAGVAFVE
LGARVLPPVPDRTGQRRAALGARLFHDPVLSADQHLACAGCHDPAHGWSIPAPKARGHRD
RLGRRNPPGLQTAAARSQWGWDGRRQSLVWQVLAPLTDPDEMGNPSLEPILGRLAADAGY
AARFTDAFPAAGLSADTLSAALLAYLAGLDRPTRFDRFAAGDLAALSDRAIAGLHLFRTK
ARCANCHFGPLLTDERFHNLKLSSFGEPAQDLGRFEVTGRPEDAGRFRTPSLRHLRDTAP
YGHAGLFATLAGVVNLYDRGGGEVWARNAAEAARPLHADAARLSPLIRPLGLTRDEKAAL
VAFLRTL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ttgaggtgcacctgcagcctccggtgggccgcattcagcctcgccgctgcgatcatggtc
ggcgtgctgccatccggcgggcaggggccggaggtcgccgccgacctgcgccgggcctat
tccggacctccggagaactggcccgcgccctggatcgaggccggggtggcgttcgtggaa
ctcggtgcgcgggtcctgcccccggtgcccgaccgcaccgggcagcggcgcgccgcgctc
ggcgcgcggctgtttcatgatccggtcctctccgccgaccagcacctcgcctgcgccggc
tgtcacgacccggcgcatggctggagcattccggcgccgaaggcgcgaggccatcgggat
cggctcggccgccgcaatccgcccggccttcaaaccgctgcggcgcgcagccaatggggc
tgggacggccggcgacaatccctcgtctggcaggtgctggcgccgctcaccgatccggac
gagatggggaatccctcgctcgaaccgatcctcgggcggctcgcggccgatgccggctat
gcggcgaggttcaccgatgccttcccggccgcaggcctctcggcggacacgctctcggcc
gcgcttctcgcctacctggccgggctcgacaggccgacccgcttcgaccgcttcgccgcc
ggggaccttgcggccttgtccgaccgggcaatcgcgggcctccacctgttccgcaccaag
gcgcgttgcgccaactgccatttcggcccgctgctcacggatgagcgcttccacaacctg
aagctctcgtccttcggcgagcccgcgcaggatctcggccgtttcgaggtcactggccgg
ccggaggatgccggccgcttccgcacgccgagcctgcgccacctgcgcgacaccgcgcct
tacggccatgccgggctgttcgcgacgctggcgggagtcgtcaatctctacgaccggggc
ggtggcgaggtctgggcccgcaacgccgccgaggccgcccgcccgctccacgcggacgcc
gcgcggctctcgccgctgatacggccgctcggtctgacccgcgacgagaaggcggccttg
gtcgccttcctcaggacgctctga

DBGET integrated database retrieval system