KEGG   Methylobacterium nodulans: Mnod_4930Help
Entry
Mnod_4930         CDS       T00839                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mno  Methylobacterium nodulans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mno00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mno00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5014748..5016037)
Genome map
AA seq 429 aa AA seqDB search
MDRIHITGGAPLHGEIPISGAKNAALPLMIASLLTGETVELANVPRLADIASLLRILGNH
GVDHMVVGKRPGQTAETGQTIRLTASNVIDTTAPYELVSTMRASFWVIAPLLARFGEARV
SMPGGCAIGTRPVDLLLMAMERLGATIEIDGGYVVARTRNGLRGAEIVFPKVTVGGTHVA
LMAASLAQGTTVIDNAAREPEVVDLAECLSKMGARIEGAGTPRIVVEGVSRLGGARHEVL
PDRIETGTYAMAVAMTGGDVILRDTRADLLHSALDVLATTGTEVTALPNGIRVRRNGAGV
AAVDVTTDPFPGFPTDLQAQFMALMTKARGQSRIRETIFENRFMHVQELARLGARIRLEG
DLAVVDGVERLRGAPVMATDLRASVSLVIAGLAAEGETIINRVYHLDRGFEALEAKLSRC
GAQIRRERV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtatccacatcaccggcggcgcgccgctccacggggagatcccgatctcgggc
gcgaagaacgcggccctgccgctgatgatcgcgagcctgctcacgggcgagaccgtcgag
ctcgccaatgtgccgcgtctcgccgacatcgcctcgctcctgcgcatcctcggcaatcac
ggcgtcgaccacatggtggtgggcaagcgccccggccagacggccgagaccggccagacc
atccgtctcacggcgagcaacgtcatcgacacgacggcgccctacgagctcgtctcgacc
atgcgggcgagcttctgggtgatcgcgccgctgctcgcgcggttcggcgaggccagggtc
tcgatgccgggcggctgcgccatcggcacgcgcccggtcgacctgctgctgatggcgatg
gagaggctcggcgccacgatcgagatcgacggcggctacgtggtggcccgcacccgcaac
ggcctgcgcggggccgagatcgtgtttccgaaggtgacggtgggcggcacgcacgtggct
ctcatggcggcctcgctcgcccagggcacgaccgtgatcgacaacgccgcccgcgagccg
gaggtcgtcgatctggcggagtgcctcagcaagatgggcgcgcgcatcgagggggcgggc
acgccgcggatcgtggtcgagggcgtgtcccgcctcggcggcgcccggcacgaggtactg
cccgaccggatcgagaccggcacctacgccatggcggtggcgatgacgggcggggacgtg
atcctgcgggacacccgtgcggacctgctccacagcgccctcgacgtgctggcgaccacg
ggcaccgaggtcacggcgctccccaacggcatccgggtgcgtcgcaacggcgccggcgtg
gcggcggtcgacgtcaccaccgatccgttcccgggcttcccgaccgacctccaggcccag
ttcatggccctgatgaccaaggccagagggcagtcgcgcatccgcgagaccatcttcgag
aaccggttcatgcacgtgcaggaactggcgcggctgggtgcgcgcatccgcctcgagggg
gacctcgcggtggtggacggcgtcgagcggctgagaggcgcgcccgtcatggccaccgac
ctgcgcgcctcggtctccctcgtcatcgcgggcctcgccgccgagggcgagaccatcatc
aaccgggtctaccacctcgaccgcggcttcgaggccctcgaagccaagctcagccgctgc
ggcgcgcagatccggcgcgaacgggtctga

DBGET integrated database retrieval system