KEGG   Methylobacterium nodulans: Mnod_5120Help
Entry
Mnod_5120         CDS       T00839                                 

Definition
isochorismatase hydrolase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mno  Methylobacterium nodulans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mnod_5120
Enzymes [BR:mno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Mnod_5120
    3.5.1.-  
     Mnod_5120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5181581..5182213)
Genome map
AA seq 210 aa AA seqDB search
MIEPCDTDVLLVVDVQRDFLPGGALAVPDGDAVVAPITALGRLFPHVVLTQDWHPPGHAS
FASSHPGRQPFDTIALAYGEQVLWPDHCVMGTSGAALAEGLDLPHAELVIRKGYRRSIDS
YSAFVEADRRTPTGLAGYLRERGITRVVLCGLATDYCVGWSALDARAAGFEAVLVEDACR
AIDQGGSLARAFAAMDAAGVARVRAEAVAG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagccctgcgacacggacgtcctcctcgtggtggacgtccagcgcgacttcctg
ccgggcggcgccctcgcggtgccggacggcgacgccgtggtggcgccgatcacggcgctc
ggccggcttttcccgcatgtcgtcctcacgcaggactggcatccgccgggccatgcctcc
ttcgcatcgagccatccgggccggcagcccttcgacaccatcgcgctcgcctatggcgag
caggtgctctggccggaccattgcgtgatgggcacctccggcgcggccctggcggagggg
ctcgacctgccgcatgcggagctggtgatccgcaagggctaccggcggtccatcgacagc
tactcggccttcgtcgaggcggaccggcgcacccccaccgggctcgcgggctacctgcgc
gagcggggcatcacccgggtcgtgctgtgtgggctggcgacggattactgcgtcggctgg
agtgcgctcgacgcgcgggcggccggtttcgaggccgtgctggtagaggatgcttgccgc
gccatcgaccagggcggctcgctggcgcgggccttcgcggcgatggacgcggcgggggtg
gcgcgggttcgcgcggaggcggtggccggctga

DBGET integrated database retrieval system