KEGG   Methylobacterium nodulans: Mnod_5242Help
Entry
Mnod_5242         CDS       T00839                                 

Definition
NAD-binding 3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mno  Methylobacterium nodulans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mnod_5242
   01212 Fatty acid metabolism
    Mnod_5242
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mnod_5242
   00650 Butanoate metabolism
    Mnod_5242
  Lipid metabolism
   00071 Fatty acid degradation
    Mnod_5242
   01040 Biosynthesis of unsaturated fatty acids
    Mnod_5242
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mnod_5242
   00310 Lysine degradation
    Mnod_5242
   00380 Tryptophan metabolism
    Mnod_5242
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mnod_5242
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mnod_5242
   00281 Geraniol degradation
    Mnod_5242
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Mnod_5242
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mnod_5242
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mnod_5242
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mnod_5242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5311743..5313944
Genome map
AA seq 733 aa AA seqDB search
MDLTNFRFETDSDGIALATWDMPGRSMNVITPEVIAELDRIVDAVAADASIKGCVITSGK
DAFSGGADLTMLQGLGAEYARLARERGEEEAMRFFFEESRRLTLLYRKLETCGKPFAAAV
HGACLGGAFELALACHHRILSDDDKTRVGLPEIKVGLFPGAGGTQRVARLMQTGDALQML
FKGEQIRPLMARNMGLVHAVAKREEIVDQAKAWIKNGGSAVAPWDQPKFKAPSGKVYSPA
GMMTWPPANAIYRRETHDNYPAAKAILQSVYEGLQLPMDLALKVESRYFAKILRSPEAAA
MIRSLFISMGELNKGARRPASVGPVSLKRVGVVGAGFMGAGIAYVTAQAGLEVVLIDQSV
EAAEKGKAYAHKLVTDQIMKGRAKTADRDALLARITATADYAALSGCDLVIEAVFEDPTV
KAEVIAKVEAAIPPGAIFASNTSTLPITGLAKASSRPDQFIGIHFFSPVEKMMLVEIIMG
RATGERALAASLDYVRAIKKTPIVVNDARGFFANRCVGAYILEGHLMLAEGVPAAMIENA
GRQAGMPVGPLSLNDEVGVDLGLKILKATKAQLGDGAVNPVQERILTALVEREGRLGRKN
RKGFYDYPEAGPKRLWPGLADLAGARLDPDAVDFFELKQRLLVAQAVEAARVYGEGVVTD
PREADVGSILGFGFAPFTGGVLSYIDGMGARRFVELCRRLEARHGGRFTPPGNLIAMAET
GGGFYRPAETQAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggacctcacgaacttccgcttcgagaccgattccgacggcatcgcgctcgcgacctgg
gacatgcccggccgctcgatgaacgtcatcaccccggaggtgatcgccgagctcgaccgg
atcgtcgacgcggtggcggctgacgcgtccatcaagggctgcgtcatcacctcgggcaag
gatgccttctcgggcggcgccgacctgacgatgctgcaggggctcggggcggaatatgcc
cggctcgcgcgggagcgcggcgaggaggaggccatgcgcttcttcttcgaggaatcgcgc
cgcctcacgctcctctaccggaagctcgagacctgcgggaagcccttcgcggcggccgtg
cacggcgcctgcctcgggggcgccttcgagctggcgctggcctgccaccaccgcatcctc
tcggatgacgacaagacccgcgtcggcctgcccgagatcaaggtcgggctgttcccgggc
gccggcggcacccagcgcgtcgcccgcctgatgcagaccggcgacgccctccagatgctg
ttcaagggcgagcaaatccgcccgctcatggcccgcaatatgggcctcgtccatgcggtc
gccaaacgcgaggagatcgtcgatcaggccaaggcctggatcaagaacggcggctcggcc
gtcgcgccctgggaccagccgaagttcaaggcgccctcgggcaaggtctactcgcccgcc
ggcatgatgacctggccgcccgccaacgccatctaccgccgcgagacccacgacaactac
ccggccgcgaaggcgatcctgcaatccgtctacgagggcctgcagctgccgatggatctc
gcgctcaaggtcgagagccgctacttcgccaagatcctgcgctcgccggaagccgcggcg
atgatccgctcgctcttcatctcgatgggcgaactcaacaagggcgcccggcgccccgcc
tcagtcggtcccgtcagcctgaagcgcgtcggcgtcgtcggcgccggcttcatgggcgca
gggattgcctatgtcacggcccaggccggactggaggtcgtcctcatcgaccagtcggtc
gaggcggccgagaagggcaaggcctacgcccacaagctcgtcaccgaccagatcatgaag
gggcgcgccaagaccgcggatcgggacgcgctcctcgcccgcatcaccgccacggccgat
tatgcggcgctttcgggctgcgacctcgtgatcgaggcggtgttcgaggacccgacggtc
aaggccgaggtcatcgccaaggtcgaggcggcgatcccccccggggccatcttcgcctcc
aacacctccacgctgccgatcaccggcctggccaaggcgtcgagccggcccgaccagttc
atcggcatccacttcttctcgccggtcgagaagatgatgctggtcgagatcatcatgggc
cgggcaaccggcgagcgggcgctcgccgcttccctcgactacgtgcgagcgatcaagaag
acgccgatcgtggtcaacgatgcccgcggcttcttcgccaaccgctgcgtcggcgcctat
atactcgaagggcacctgatgctcgccgagggcgtgccggccgcgatgatcgagaatgcc
ggccggcaggccggcatgccggtgggtccgctctccctcaacgacgaggtcggcgtcgac
ctcgggctgaagatcctgaaggccaccaaggcgcagctcggggacggcgcggtcaacccg
gtgcaggagcgcatcctcacggcgctcgtcgagcgggaaggccggctcggacgcaagaac
cgcaagggcttctacgactatcccgaggccgggccgaagcggctctggcccggcctcgcg
gatctggccggcgcgcgcctcgaccccgacgcggtggatttcttcgagctgaagcagcgc
ctcctggtggcgcaggcggtcgaggccgcccgggtctacggcgagggcgtggtgacggat
ccgcgcgaggccgatgtcggttcgatcctcggcttcggctttgcgcccttcacgggcggc
gtcctgtcctacatcgacgggatgggcgcgcggcgtttcgtggagttgtgccggcgcctg
gaggccaggcacggcggccgcttcacgccgcccggcaacctgattgccatggcggagacg
ggcgggggattctatcgccctgccgaaacgcaggcggcctga

DBGET integrated database retrieval system