KEGG   Methylobacterium nodulans: Mnod_5332Help
Entry
Mnod_5332         CDS       T00839                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mno  Methylobacterium nodulans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mnod_5332
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mnod_5332
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mnod_5332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5409027..5409518)
Genome map
AA seq 163 aa AA seqDB search
MTAIYDFSPAAADGTPHPLAAYRDHVLLIVNTASRCGFTPQYEGLEALWRRHRAAGLVVL
GFPCNQFGAQEPGDADEIARFCRLTYAVSFPVLAKVAVNGPGADPLFVYLKRARPGLLGT
RSIKWNFTKFLVGRDGSVIGRYPPRTRPAALEGAIVAALRAAA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgatctacgacttctcccccgctgcggccgatggcacgccgcacccgctcgcc
gcctaccgcgaccacgtcctgctcatcgtcaacacggcctcgcgctgcggcttcactccg
caatacgaggggctggaggcgctctggcgccggcacagggcggcgggcctcgtggtgctc
ggcttcccctgcaaccagttcggcgcccaggaacccggcgatgccgacgagatcgcccgc
ttctgccgcctcacctacgcggtctccttcccggtgctcgccaaggtggcggtgaacggg
ccgggggccgatccgctcttcgtctacctcaagcgcgcgcggccggggctcctcggcacc
cggtcgatcaagtggaacttcaccaagttcctggtcgggcgcgacggaagcgtcatcggc
cgctacccgccgcgcacgcggcccgccgccctggagggcgccatcgtggcggcactgcgc
gcagccgcctga

DBGET integrated database retrieval system