KEGG   Methylobacterium nodulans: Mnod_5387Help
Entry
Mnod_5387         CDS       T00839                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mno  Methylobacterium nodulans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mnod_5387
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mnod_5387
  Lipid metabolism
   00071 Fatty acid degradation
    Mnod_5387
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mnod_5387
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mnod_5387
   00626 Naphthalene degradation
    Mnod_5387
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mnod_5387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5470795..5471775
Genome map
AA seq 326 aa AA seqDB search
MHAMVLPRVGGPLVHETRPDPVPGPGEVRIRVEACAVCRTDLHIIDGELPDPRLPLVLGH
EIVGLVEALGPGVTAPAIGERVGVPWLGHTCGRCPHCAAGRENLCDAPGFTGYSRDGGFA
SHVVAEAAFTIALDRAADPVATAPLLCAGLIGWRTLRMAGEAEAVGLYGFGAAAHIVAQV
CRWQGRRVYAFTRPGDRAGQDFARSLGAAWAGDADALPPAPLDAALIFAPDGRLVPAALR
AIRKGGSVVCGGIHMSDIPAFPYTLLWGERRIVSVANLTREDASSFFAVAPRAGIVTRTR
TFPLRDANAAVAAHRAGLHGAAVLVP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgatggtcctgcccagggtcggcggcccgctcgttcacgagacccgtcccgat
ccggttccgggccccggcgaggtccgcatccgggtcgaggcctgcgcggtctgccgcacg
gatctccacatcattgacggcgagctgccggatccgcggctcccgctcgtcctcggccac
gagatcgtgggcctcgtcgaggcgttggggcccggggtcacggcgcccgccatcggggag
cgggtcggcgtgccgtggctcggccatacctgcggccgctgcccccactgcgccgcgggc
cgcgagaatctctgcgatgcgccgggcttcaccggctacagccgggacgggggttttgcc
agccacgtcgtggccgaggccgccttcacgatcgcgctcgaccgcgccgcggatccggtc
gcgacggcgccgctcctgtgcgcggggctgatcggctggcgaaccctgcgcatggcgggc
gaggcggaggcggtcggcctctacggcttcggcgccgcggcccatatcgtcgcccaggtc
tgtcgctggcagggccgccgggtctatgccttcacgcggccgggcgaccgggcgggtcag
gacttcgcccgctcgcttggcgccgcatgggccggggatgccgatgcgctgccccccgcc
ccgctggatgccgcgctgatcttcgcgccggatggccgcctcgtgcccgcggccctgcgc
gcaatccgcaagggcggcagcgtggtctgtggcgggatccacatgagcgacatccccgct
tttccctacacgctgctgtggggcgaacggcggatcgtctcggtcgccaacctcacgcgg
gaggatgccagcagcttcttcgcggtggctccccgggccgggatcgtgacgcggacccgc
acctttccgctgcgcgacgccaatgcggcggtcgcggcgcaccgcgccggcctgcatggg
gcggccgtcctcgttccgtag

DBGET integrated database retrieval system