KEGG   Methylobacterium nodulans: Mnod_5571Help
Entry
Mnod_5571         CDS       T00839                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mno  Methylobacterium nodulans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:mno01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mno01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mno00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mno00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mno00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:mno00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5685469..5686230)
Genome map
AA seq 253 aa AA seqDB search
MAGLRPRPLVAGNWKMNGTRASLPVLEAVIAGLTPELASRIDVLVCPPATLVGTFAAAAA
GTPVRIGGQDVHAAPSGAHTGCIAAEMLADLGATHTIVGHSERRADQHETDAQVCAKALG
ARRAGLVAIICVGETREEREAGRTLAVVRGQLAGSLPDGATAADTVIAYEPVWAIGTGLT
PTAADVAEVHGLIRRELQARLGAEGDRVRILYGGSVKPSNAAELMAVPNVDGALVGGASL
KAEDFLGIAAAYA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctgggctgcgaccgcgtccgctggtggcgggaaactggaagatgaatggcacgcgg
gcctcgcttccggtgctggaggccgtgattgccgggctgacgccggagctggcctcccgc
atcgacgtgctggtctgcccgcccgcgaccctcgtcggcaccttcgcggccgccgccgcc
ggcacgccggtgcgcatcggcggccaggacgtgcatgcggccccgagcggcgcccatacg
ggctgcatcgccgccgagatgctggccgatctcggcgccacgcacacgatcgtcggccat
tccgagcggcgggctgaccagcacgagaccgacgcgcaggtgtgcgccaaggcgctcggc
gcccggcgggccggcctcgtcgccatcatctgcgtgggcgagacccgggaggagcgcgag
gccggccgcaccctcgcggtggtgcgcggccagctcgccggctccctgccggacggcgcc
accgccgccgacacggtgatcgcctacgagccggtctgggcgatcgggacggggctcacg
cccaccgccgccgatgtggcggaggtgcacgggctgatccgccgggagcttcaggcgcgg
ctcggcgccgagggggaccgggtccgtatcctctatggcggctcggtgaagccgtcgaac
gccgccgagctgatggcggtgccgaatgtcgacggggccctggtcggcggcgcgagcctg
aaggcggaggatttcctcggcatcgcggcggcctacgcgtag

DBGET integrated database retrieval system