KEGG   Methylobacterium nodulans: Mnod_5571Help
Entry
Mnod_5571         CDS       T00839                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mno  Methylobacterium nodulans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mnod_5571
   01230 Biosynthesis of amino acids
    Mnod_5571
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mnod_5571
   00051 Fructose and mannose metabolism
    Mnod_5571
   00562 Inositol phosphate metabolism
    Mnod_5571
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mnod_5571
Enzymes [BR:mno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mnod_5571
Exosome [BR:mno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mnod_5571
  Exosomal proteins of bladder cancer cells
   Mnod_5571
  Exosomal proteins of melanoma cells
   Mnod_5571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5685469..5686230)
Genome map
AA seq 253 aa AA seqDB search
MAGLRPRPLVAGNWKMNGTRASLPVLEAVIAGLTPELASRIDVLVCPPATLVGTFAAAAA
GTPVRIGGQDVHAAPSGAHTGCIAAEMLADLGATHTIVGHSERRADQHETDAQVCAKALG
ARRAGLVAIICVGETREEREAGRTLAVVRGQLAGSLPDGATAADTVIAYEPVWAIGTGLT
PTAADVAEVHGLIRRELQARLGAEGDRVRILYGGSVKPSNAAELMAVPNVDGALVGGASL
KAEDFLGIAAAYA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctgggctgcgaccgcgtccgctggtggcgggaaactggaagatgaatggcacgcgg
gcctcgcttccggtgctggaggccgtgattgccgggctgacgccggagctggcctcccgc
atcgacgtgctggtctgcccgcccgcgaccctcgtcggcaccttcgcggccgccgccgcc
ggcacgccggtgcgcatcggcggccaggacgtgcatgcggccccgagcggcgcccatacg
ggctgcatcgccgccgagatgctggccgatctcggcgccacgcacacgatcgtcggccat
tccgagcggcgggctgaccagcacgagaccgacgcgcaggtgtgcgccaaggcgctcggc
gcccggcgggccggcctcgtcgccatcatctgcgtgggcgagacccgggaggagcgcgag
gccggccgcaccctcgcggtggtgcgcggccagctcgccggctccctgccggacggcgcc
accgccgccgacacggtgatcgcctacgagccggtctgggcgatcgggacggggctcacg
cccaccgccgccgatgtggcggaggtgcacgggctgatccgccgggagcttcaggcgcgg
ctcggcgccgagggggaccgggtccgtatcctctatggcggctcggtgaagccgtcgaac
gccgccgagctgatggcggtgccgaatgtcgacggggccctggtcggcggcgcgagcctg
aaggcggaggatttcctcggcatcgcggcggcctacgcgtag

DBGET integrated database retrieval system