KEGG   Methylobacterium nodulans: Mnod_5981Help
Entry
Mnod_5981         CDS       T00839                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mno  Methylobacterium nodulans
Pathway
mno00790  Folate biosynthesis
mno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mnod_5981
Enzymes [BR:mno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Mnod_5981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACL60808
JGI: Mnod5981
UniProt: B8ITV0
Position
complement(6086537..6087052)
Genome map
AA seq 171 aa AA seqDB search
MADAYLGLGSNLGDKAAMLTRAIAALDATPGLRVTARSRFYRTPPWGDTDQDWFLNAAVA
VETALSPHALLEACLAIEARLGRVRERRWGPRVIDIDVLHYAGAVVEDERLVLPHRFVRE
RAFVLVPLAEIAPDLVIGGETVVQALAKLDRSGIEPDEAGGAAPCTPARGA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcctatctgggcctgggcagcaacctcggcgacaaggccgccatgctgacc
cgcgccatcgccgcgctcgacgccacgccgggcctgcgcgtgaccgcacgctcgcgcttc
taccgcacgcccccctggggcgacaccgaccaggactggttcctcaacgccgccgtcgcg
gtcgagaccgcgctgtcgccccacgccctgctcgaagcctgcctcgccatcgaggcccgc
ctcggccgcgtgcgcgagcggcgctgggggccgcgcgtcatcgacatcgacgtgctccac
tatgcgggcgccgtggtggaggacgagcgcctcgtcctgccccaccgcttcgtgcgcgag
cgcgccttcgtgctcgtgccgcttgccgaaatcgcgcccgatctcgtgatcgggggcgag
acggtcgtgcaggccctggcgaagctcgatcgcagcggcatcgagcccgacgaggcaggg
ggcgccgccccctgcaccccggccagaggggcgtga

DBGET integrated database retrieval system