KEGG   Methylobacterium nodulans: Mnod_6055Help
Entry
Mnod_6055         CDS       T00839                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mno  Methylobacterium nodulans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mnod_6055
Enzymes [BR:mno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mnod_6055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6168473..6169411)
Genome map
AA seq 312 aa AA seqDB search
MTDIGEDPDLFVLGSFVAACSAMVARQPRPGETLEAQAFWLDPGGKGLNLAVGARRLGAR
VDGLVAVGRDPFGDMAEAALRRAGLPAAMLRRVDAPTGAGIGLVDAAGENCIAVFPGANA
HLDSAAVAQAAGRLIRARCVLAQFEIGEAPIAEAFRRARAAGVATLLNPSPFRPVPAALL
ADTTILVLNATEAAALREDLGLPTGAWEDLVAALLARGPRIVVVTLGERGALAREAGGPL
LTQPAFPVAAVDTIGAGDAFTAGLAVALVENRPLAEALRQAAACGACVVARPGVFDALPD
RAARDAILAAGA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacatcggagaggatccggacctgttcgtcctggggagcttcgtggcggcctgt
tctgccatggttgcgcggcagccgcgacccggggagacgctggaggcgcaggccttctgg
ctcgatcccggtggtaaaggactgaaccttgccgtcggtgcccggcgcctcggcgcccgg
gtcgacggtctcgtggcggtcggccgcgacccgttcggcgacatggcggaggcggccctg
cggcgggccggcctgccggccgcgatgctgcgccgggtggatgcgcccacgggggcgggg
atcggcctcgtggatgcggccggcgagaactgcattgcggtctttccgggcgccaatgcc
catctcgattccgcggcggtggcgcaggcggcgggccgcctgatccgggcgcgctgcgtg
ctcgcgcagttcgagatcggcgaggcgccgatcgccgaagcgttccgccgcgcccgcgcg
gccggggtcgcgaccctgctcaacccctcgccgttccggccggttccggcggcgctcctc
gccgacaccaccatcctcgtcctcaacgccaccgaggcggcggccctgcgcgaggatctc
ggcctgccgacgggagcctgggaggatctcgtcgcggcgctgctggcgcgggggccgcgc
atcgtcgtggtgacgctcggcgaaaggggcgccctcgcccgggaggccggcggcccgttg
ctgacccagcccgccttcccggtcgcggcggtggacacgatcggggcgggcgatgccttc
acggccgggctcgcggttgcgctcgtggagaatcgtcccctcgccgaggccctgcgccag
gccgccgcctgcggcgcctgcgtggtcgcccggcccggcgtgttcgatgccctgcccgac
cgggcggcccgggacgcgatcctcgccgccggagcgtga

DBGET integrated database retrieval system