KEGG   Methylobacterium nodulans: Mnod_6176Help
Entry
Mnod_6176         CDS       T00839                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mno  Methylobacterium nodulans
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mnod_6176
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mnod_6176
Enzymes [BR:mno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Mnod_6176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6291823..6294321
Genome map
AA seq 832 aa AA seqDB search
MTVLTGSSRNDARAARQDAGDGFVPGPLGPQELAGLDAYWRAANYLSVGQIYLLDNPLLR
EPLAPAHVKPRLLGHWGTTPGLNFIYAHLNRVIRRRDLDMIAVWGPGHGAPGLVANAYLE
GTYSEVYPDVAPDAEGMRRLFRQFSFPGGIPSHASPELPGSIHEGGELGYSLAHAFGAAL
DNPDLIVACVVGDGEAETGALAASWHSAKFLDPRTDGTVLPILHLNGYKIANPTILARMP
EAELMSLLTGYGYDPIVVAGEEPAPMHQAMAAALDRALDRIAQIRREAGCERPRWPMIVL
RSPKGWTGPKVVGGLPVEGTWRSHQVPVAATRENPEHLAILERWMRSYRPETLFDAAGRL
VPDLAALAPAGERRLSANPQANGGRHAQPLRRPPIADHAVSVEAPGAATAEATRVLGAYL
RDVVTLNTASRNFRIMGPDETASNRLDAVLSVTNRVWQEEILPGDDHLGRTGRVMEVLSE
QLCEGWLEGYLLTGRHGLFASYEAFIHVVDSMVSQHAKWLKSSRALPWRRPVPSLNLLLS
SHVWRQDHNGFSHQDPGFIDFIANKRGDVARVYLPPDANCLLWVMDHCLGTHDRINVVVA
GKQPAPQWLAPDAAARHCAAGIGVWDFASNEGEGEPDVVMACAGDVPTMETLAAVDWLRR
AVPDLRMRVVNVVDLMTLPSPDMHPHGIEDAAFDGLFTKDRPVIFAYHGYPWLIHRLTYR
RTNHANFHVHGFQEEGTTTTPFDMAVMNRLDRHHLAIAALRRVPRLGARADRAVHALEER
LAVHRAHVCRTGEDLPEIRDWRWPQPGMAKPEESGARIQEPDREALKAGGSS
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcctgacaggctcgtctcggaacgatgcgcgcgctgcgcggcaggatgcgggc
gacggcttcgtgccgggtccgctcggcccccaggagctggcgggcctcgacgcgtattgg
cgggccgcgaactacctgtcggtcggtcagatctaccttctcgacaacccgctcctgcgc
gagccgctcgcccccgcgcatgtcaagccgcggctgctcggccattggggcaccacgccc
ggcctcaacttcatctacgcccatctgaaccgggtgatccggcggcgcgacctcgacatg
atcgcggtctgggggccgggccacggggcgccggggcttgtcgccaacgcctatctcgaa
ggaacctacagcgaggtctaccccgacgtcgcgccggacgcggagggaatgcgccggctc
ttccgccagttctcgttcccgggcgggattccgagccacgcctcgcccgaactgcccggc
tcgatccacgagggcggagagctcggctactcgctcgcccatgccttcggggccgccctg
gacaatccggacctgatcgtcgcctgcgtggtgggcgatggcgaggccgagacgggggcg
ctcgccgcctcctggcactcggcgaagttcctcgacccgcggacggacggcaccgtcctg
cccatcctccatctcaacggctacaagatcgccaatccgacgatcctggcgcgcatgccc
gaggcggagctgatgagcctgcttaccggctacggctacgatccaatcgtcgtcgccggc
gaagagccggcgccgatgcatcaggcgatggcggcggcgctcgaccgcgcgctcgaccgc
atcgcgcaaatccggcgcgaggccggctgcgagcggccgcgctggcccatgatcgtgctg
cgcagcccgaaaggctggaccggcccgaaggtcgtcggcggcctgcccgtcgaggggacg
tggcgctcgcatcaggttccggtggccgccacgcgcgagaacccggagcacttggcgatc
ctcgagcgctggatgcgctcctaccgtcccgagaccctgttcgacgccgcgggacgcctt
gtgccggacctggccgccctggccccggcgggcgagcggcggctctccgccaacccgcag
gcgaatggcgggcgccacgcccagccgctccgccggccccccatcgcggaccatgcggtg
agcgtcgaggcgcccggggccgccacggccgaggcgacgcgggtgctcggcgcctatctg
cgcgatgtcgtcaccctcaacaccgcgagccggaacttccggatcatggggccggacgaa
accgcctcgaaccgcctcgacgccgtcctgtccgtgacgaaccgggtctggcaggaggag
atcctgccgggcgacgaccatctgggccgcaccggccgggtgatggaggtgctgagtgaa
cagctctgcgagggctggctcgaaggctacctgctgaccggccgccacggcctgttcgcg
agctacgaggccttcatccacgtggtcgactcgatggtgagccagcacgccaagtggctc
aaatcctcccgcgcgctgccctggcgccggccggtcccgtcgctaaacctgctgctgtcc
tcccatgtctggcgccaggaccacaacggcttcagccaccaggatcccggcttcatcgac
ttcatcgccaacaagcgcggcgacgtcgcgcgggtctacctgccgccggacgccaattgc
ctgctgtgggtgatggaccactgcctgggcacgcatgaccgcatcaacgtggtcgtggcc
ggcaagcagcccgcgccccagtggcttgctcccgacgcggcggcgcgccactgcgcggcg
gggatcggcgtgtgggacttcgcctcgaacgagggggagggcgagcccgacgtggtgatg
gcctgcgcgggcgacgtgcccacgatggagaccctggcggcggtggactggctgcgccgg
gcggtgcccgacctgcggatgcgcgtcgtcaacgtcgttgacctgatgacgctgccctcg
ccagacatgcacccgcacgggatcgaggacgcggccttcgacgggctgttcacgaaggac
cggccggtgatcttcgcctatcacggttatccctggctgatccatcggctgacctaccgg
cgcaccaaccacgccaacttccacgtccacggctttcaggaggagggcacgaccacaacg
cccttcgatatggcagtgatgaaccgcctcgaccgccatcacctggcgatcgccgccctg
cgccgcgtaccgcgcctcggtgcacgggcggaccgggccgtgcacgcgctggaggagcgg
ctcgcggtccatcgcgcgcatgtctgtcggaccggcgaggacctgccggagatccgggat
tggcgctggccgcagccgggcatggcaaagccggaggagtcgggcgcccgcatccaggag
ccggaccgggaggcgctcaaagccggcggcagttcttga

DBGET integrated database retrieval system