KEGG   Methylobacterium nodulans: Mnod_6494Help
Entry
Mnod_6494         CDS       T00839                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mno  Methylobacterium nodulans
Brite
Enzymes [BR:mno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mnod_6494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6577588..6578253
Genome map
AA seq 221 aa AA seqDB search
MLDYAQARRLMVDCQLRTFDVTDIALLDAFDGVPRERFVPEGREAFAYIDQPLALGTEEG
ETRSMPAPMVLARLLQALAVKPGERALDVATGLGYAAALLDRIGARPVGLESLPGLSAAA
RERLAAVTGKAIPVETGPLDRGAPQHGPYNVILINGRIERRPQALLEQLADGGRLACIQG
EGRTGKATLWVRAGNAFGSRPLFDAAAPLLRAFATEPGFTF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgctcgattacgcgcaagcgcgccgcctcatggtcgattgtcagctgcggaccttcgac
gtgaccgacatcgcgctcctcgacgccttcgacggcgtcccgcgcgagcgcttcgtgccg
gagggacgggaagccttcgcgtatatcgaccagccgctcgcgctcggcacggaggaggga
gagacccgctccatgcccgccccgatggtcctcgcccgccttcttcaggcgctcgccgtc
aagccgggcgagcgggccctcgacgtcgccacgggcctcggctacgcggcggcgctcctc
gaccggatcggcgccaggccggtcggcctcgaatcgctgcccggcctctccgcggcggcc
cgcgaacggctcgccgccgtcaccggcaaggcgatcccggtcgagaccggccccctggac
aggggcgcaccgcagcacggcccctacaacgtcatcctgatcaacgggcgaatcgagcgg
cgcccgcaggccctgctggaacagctcgccgatggcggccgcctcgcctgcatccagggc
gagggccgcaccggcaaagcgaccctctgggtgcgcgccggcaacgccttcggctcacgc
cccctgttcgacgccgccgcgccgctcctgcgggccttcgcgacggagcccggcttcacc
ttctga

DBGET integrated database retrieval system