KEGG   Methylobacterium nodulans: Mnod_6518Help
Entry
Mnod_6518         CDS       T00839                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mno  Methylobacterium nodulans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mno01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mno00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mno00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mno00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6605861..6607249
Genome map
AA seq 462 aa AA seqDB search
MPINVLMPALSPTMEKGNLAKWLKKEGDTVKSGDVLAEIETDKATMEVEAIDEGVLAKIV
VPEGTADVPVNDLIALIAGEGEDPKSVSAGAGAGAKAKPAEDRTPGGGTMAYARVDAAPD
AAKAEAKPNGATRPQADGRIFASPLARRIAKQEGIDLSRIAGSGPHGRVIERDVRAALAE
GGATKAPAPARPAPKEAGEAVPPAAPTATAGALPLGLKAEQVKAMFDKGSYEEIPLDGMR
KTIAKRLVESKQTVPHFYLSLDVELDALLALREQVNAGAGQDKDGKPLFKLSVNDFVIKA
LALALQRVPNANAVWAEDRILKFRHSDVGVAVAVEGGLFTPVIRKAEQKTLSTISAEMKD
LAGRARTKKLKPDEYQGGATAVSNLGMYGIKEFGAVINPPHGTILAVGAGEARVVVKNGA
PAVVQAMTVTLSCDHRVVDGALGAELLAAFKGLIESPMGMLV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacgtcctgatgcccgccctctcgcccacgatggagaagggcaacctcgcc
aagtggctgaagaaggagggggacacggtcaagtccggcgacgtgctcgccgagatcgag
accgacaaagccaccatggaggtcgaggccatcgacgagggtgtgctcgccaagatcgtg
gtgccggagggcaccgccgacgtgccggtgaacgacctcatcgccctcatcgccggggag
ggcgaggacccgaagagcgtgagcgccggggccggagccggggccaaggcgaagcccgcc
gaggaccgcacgcccggcggcgggacgatggcctacgcccgggtggacgcggcgccggat
gccgcgaaggccgaggcgaagccgaacggcgccactcggccgcaggcggacgggcggatc
ttcgcctcgccgctcgcgcgccgcatcgccaagcaggaggggatcgacctttcgcgcatc
gcgggctcagggccgcatggccgggtgatcgagcgcgacgtgcgcgcggccctggcggag
ggcggcgccaccaaggcgccagccccggcccggcccgccccgaaggaggccggggaggcg
gtcccgcccgccgcccccacggcgacggccggcgcgctccccctcggcctgaaggccgag
caggtcaaggcgatgttcgacaaggggtcctacgaagaaatccccctcgacgggatgcgc
aagaccatcgccaagcgcctcgtcgagtcgaagcagaccgtcccccacttctatctctcg
ctcgacgtcgagctcgatgcgcttctggccctgcgcgagcaagtcaatgccggggcgggc
caggacaaggacggcaagccgctgttcaagctctcggtgaacgatttcgtcatcaaggcc
ctggccctggcactgcagcgggtgccgaacgccaacgcggtctgggccgaggaccggatc
ctgaagttccgccactccgatgtcggcgtcgccgtggcggtggagggcggcctgttcacg
ccggtgatccgcaaggcggagcagaagacgctctcgaccatctcggccgagatgaaggac
ctcgccggtcgcgcccgcacgaagaagctgaagcccgacgagtaccagggcggggcgacg
gcggtgtcgaatctcggcatgtacggcatcaaggagttcggcgccgtcatcaacccgccc
cacggcaccatcctggcggtgggggccggggaggcgcgcgtcgtcgtcaagaacggcgcc
cccgcggtggtgcaggccatgaccgtgacgctctcctgcgaccaccgggtggtggacggg
gcgctcggcgccgagctgctcgcggccttcaagggcctgatcgagagcccgatggggatg
ctggtgtga

DBGET integrated database retrieval system