KEGG   Methylobacterium nodulans: Mnod_7173Help
Entry
Mnod_7173         CDS       T00839                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mno  Methylobacterium nodulans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mno00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7257597..7258256
Genome map
AA seq 219 aa AA seqDB search
MDAVLKSLSVRLPDAADRRSDVARPERITERPTRQEAEAAVRTLIRWAGDDPEREGLRET
PQRVARAYEQIFGGYRQDPTNILDRVFEEVEGYGDIVLVRDIPFHSHCEHHMVPFIGKAH
IAYYPRRGVVGLSKLARVVDAFARRLQTQETMTAQIAETIDSVLNPRGVAVMVEAEHLCM
AMRGVQKAGVSTLTTQFTGVFKQDPHEQVRFLTLVRDQR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggatgcggtgctgaagtccttgtcggttcggttgccggatgcggccgacaggcgcagc
gacgtggcccgtccggagcgcatcaccgaacgcccgacccgccaggaggcggaggccgcc
gtgcgcacgctgatccgctgggcgggcgacgatccggagcgcgagggcctgcgcgagacg
ccccagcgcgtcgcgcgcgcctacgagcagatcttcggcggctaccgccaggacccgacc
aacatcctcgaccgggtgttcgaggaggtcgagggctacggcgacatcgtgctggtgcgc
gacatcccgttccactcgcattgcgagcaccacatggtgccgttcatcggcaaggcccac
atcgcctactacccgcgccgcggggtggtcgggctctcgaagctcgcccgggtggtcgat
gccttcgcgcgccgcttgcagacgcaggagaccatgacggcccagatcgccgagacgatc
gattcggtgctcaatccccgcggcgtcgccgtgatggtcgaggccgagcatctctgcatg
gcgatgcgcggcgtgcagaaagccggcgtctcgaccctcaccacgcagttcaccggcgtg
ttcaagcaggacccgcacgagcaggtccgcttcctcaccctcgtgcgcgaccagcgctga

DBGET integrated database retrieval system