KEGG   Methylobacterium nodulans: Mnod_7192Help
Entry
Mnod_7192         CDS       T00839                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mno  Methylobacterium nodulans
Pathway
mno00010  Glycolysis / Gluconeogenesis
mno00020  Citrate cycle (TCA cycle)
mno00620  Pyruvate metabolism
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
mno01130  Biosynthesis of antibiotics
mno01200  Carbon metabolism
Module
mno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mnod_7192
   00020 Citrate cycle (TCA cycle)
    Mnod_7192
   00620 Pyruvate metabolism
    Mnod_7192
Enzymes [BR:mno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mnod_7192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACL61932
JGI: Mnod7192
UniProt: B8IKE7
Position
7279362..7280684
Genome map
AA seq 440 aa AA seqDB search
MATEVKVPDIGDFKDVPIIEVHVKEGDSIGPDDPLISLESDKATMEVPSPSAGVVEKLLI
KIGDKVSEGHPILLLKGEGEARGEAKGNGAAAAADTAALMSRQEPPPAPSAPAPQAPAPQ
APAPAPAPAPSAIPDFSQVHASPAVRRLARELGVDLTAIKGTGEKGRVTKEDVKGHLTRA
VAPAAAGGVVFPGGGMGIPEIPAVDFEKFGPIETRPLARIKKISGPHLHRAWLNVPLVTH
QDEADITETDAYRKDLDTTAKEKGYRVTLLAFLIKAAVSALRQHPEFNASLSPDKESLIL
KRYYNIGVAVDTPDGLVVPVVKDAERKGITEISQELGALSKKARDGKLSSGDMQGASFTI
SSLGGIGGTAFTPLVNAPEVAILGVVRSRMAPVWDGSEFKPRLMLPLSVSYDHRVIDGAL
AARFTRHLAHVLEDVRRLVI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaccgaggtcaaggttccggatatcggtgatttcaaggatgtcccgatcatcgag
gtgcatgtgaaggagggcgacagcatcgggccggacgacccgctgatctcgctcgaatcc
gacaaggccaccatggaggtgccctcgccctccgccggcgtggtcgagaagctcctgatc
aagatcggcgacaaggtgagcgaggggcacccgatcctgctcctcaagggcgagggcgag
gccaggggcgaggccaaaggcaacggcgcggccgccgcggccgataccgcggccctgatg
tcccggcaggagcccccacccgccccgagcgcccccgcgccgcaggcgccagccccgcag
gccccggccccggctccggctccggccccctcggcgatcccggacttctcgcaggtccat
gcgagcccggccgtgcggcggctggcccgcgagctcggcgtcgacctcaccgccatcaag
ggcaccggcgagaagggccgcgtcaccaaggaggacgtgaagggccacctgacgcgcgcg
gtcgctccggcggccgccggcggcgtggtcttcccgggcggcggcatgggcatcccggag
atcccggccgtcgacttcgagaagttcgggcccatcgagaccaggccgctcgcccggatc
aagaagatctcggggccgcacctgcaccgggcgtggctcaacgtgccgctcgtcacccat
caggacgaggccgacatcaccgagaccgacgcctaccgcaaggacctcgacacgaccgcc
aaggagaagggctaccgcgtcacgctgctcgccttcctgatcaaggccgcggtctcggcg
ctgcgccaacaccccgagttcaacgcctcgctgtcgcccgacaaggaatctctgatcctc
aagcgctactacaatatcggcgttgcggtcgacacgccggacgggctggtggtgccggtg
gtcaaggatgccgagcgcaagggcatcaccgagatcagccaggagctcggcgcgctctcg
aagaaggcccgcgacggcaagctgtcgagcggcgacatgcagggggcgagcttcacgatc
tcgtcgctcggcggcatcggcggcaccgccttcacaccgctcgtcaacgcgcccgaggtg
gcgatcctgggcgtcgtgcgctccaggatggcgccggtctgggacgggtccgagttcaag
ccgcggctgatgctgccgctctcggtctcctacgaccaccgggtcatcgacggggcgctc
gccgcccgcttcacccgccacctcgcccacgtcctggaggacgtgcggcggctcgtgatc
tga

DBGET integrated database retrieval system