KEGG   Methylobacterium nodulans: Mnod_7245Help
Entry
Mnod_7245         CDS       T00839                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mno  Methylobacterium nodulans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mnod_7245
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mnod_7245
   00650 Butanoate metabolism
    Mnod_7245
  Energy metabolism
   00190 Oxidative phosphorylation
    Mnod_7245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7340272..7340685)
Genome map
AA seq 137 aa AA seqDB search
MVDNRPEATRTIRTAYARVQGLGPAHHGTSEWWLHRVTAVSNIPLIVSFVVIVALCAGRS
YEDAVRLVSHPLVAILLILGVLSVTNHMRMGLQIVIEDYVHDKGLKIAAVIANTFYSVVV
AVACLYAIVRISLRAFV
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaaccgtcccgaggccacccgcaccatccgcaccgcctatgcccgcgtccag
gggctcggcccggcccatcacggcacgagcgaatggtggctgcaccgcgtcaccgcggtc
tccaacatcccgctcatcgtctccttcgtggtgatcgtggcgctctgcgccggccgctcc
tacgaggacgcggtgcgtctcgtgtcgcacccgctcgtcgcgatcctgctcatcctcggc
gtcctctcggtgacgaatcacatgcggatgggcctgcagatcgtcatcgaggattacgtg
cacgacaaggggctgaagatcgcggcggtgatcgccaacaccttctacagcgtcgtcgtg
gcggtcgcctgcctctacgccatcgtgcggatcagcctgcgcgccttcgtctga

DBGET integrated database retrieval system