KEGG   Methylobacterium nodulans: Mnod_7397Help
Entry
Mnod_7397         CDS       T00839                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mno  Methylobacterium nodulans
Brite
Enzymes [BR:mno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mnod_7397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7482100..7482765)
Genome map
AA seq 221 aa AA seqDB search
MGDEAEHSDAVGAAAFVLALRARGVRAPAVLGAMERVPRERFAPEALRDLARRDIALPLA
CGQTMTAPSAVAAMLAVLEPGPGARALEIGTGSGYATALLLRLGCAVVESLERYETLAGE
AQGRLDALGLAGSVRLRIADGCAPEKDVTPFDRILVNGALPAIPDSLGQRLAPGGRLVGA
VATREGMRLAVVERGPDGLHRRILDTALRIAPLTAGRARVL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgggggacgaggccgagcattccgacgccgtcggagccgccgccttcgtgctggccctg
cgcgcccgcggcgtgcgcgctcccgccgtgctcggcgccatggagcgggtgccccgcgag
cgtttcgcccccgaggcgctccgcgatctcgcccgccgggacatcgccctgccgctcgcc
tgcggccagaccatgaccgcgccaagcgccgtcgccgccatgctggccgtgctcgagccc
ggaccgggcgcccgcgccctcgagatcggcacgggctcgggctacgccaccgcactactc
ctgcgcctcggctgcgcggtggtcgaaagcctggagcgctacgagaccctggccggagag
gcccaggggcgtctcgatgccctcgggctggccggatcggtgcggctgcggatcgccgat
ggctgcgcgcccgagaaggacgtgacgcccttcgaccgcatcctggtcaacggcgccctg
ccggcgatcccggacagcctcggccagcgcctcgccccgggcggacgcctcgtcggggcg
gtcgcgacccgggagggcatgcgcctcgcggttgtggagcgcggccccgacggcctgcac
cgtcgcatcctcgacacggccctgcgcatcgcgccgctcaccgccggccgcgcccgcgtg
ctgtag

DBGET integrated database retrieval system