KEGG   Methylobacterium nodulans: Mnod_7548Help
Entry
Mnod_7548         CDS       T00839                                 

Definition
putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
mno  Methylobacterium nodulans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mnod_7548
Enzymes [BR:mno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mnod_7548
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     Mnod_7548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7651396..7656324)
Genome map
AA seq 1642 aa AA seqDB search
MAVSEDVVARLARLAGLAADYVDAFGSPIETPLDARRGVLAALGLPSGTEEEARSSLARI
EALRHGLVPPLVPVEARRASRVPVRADRNGTLNWRVVDERGSARDGRAPIALGGGTPAFD
LPPLTPGYHRLTVTLGDKRAEATVIAAPQRCWRPRALGEEGARDWGLAVQLYGLRSAENL
GIGTYTDAGRAATDAGARGAAFLGLSPVHALFPSDRHKVSPYSPSSRLFLETLYIDPQAV
PGFAGSRAASLLDAMRPQVERLREAALVDHAGVWEVLGPVLDALWQESRARAGQDTEFLA
FRAAGGESLEAHATFDALSEHFRRQGASWLGEWPEEYRRNGTPAVLAFAAEHPERIAYYA
WLQFIADRQLAAAAAAAQAAGMRLGLYRDLAVGADRGGSEVWSNPERFATGLSIGAPPDL
LAPNGQDWGLPPFDPLELERDGLAAFRALVQANMRHAGAIRIDHAFQLARLYLIPAGQGA
KAGAYVAMPFEPMLAVLRLESHRAKCLVIAEDLGTAPQGFSDALMQAGILSYRILAFERG
EGGSFKSPEAYPRDALCAITTHDLPTFVGWWRGVDTDLRQSLGLYDGERADAERAERVTE
RRRLTEALHSENLQPGAEPPDQPPFDAAARYLARAPSVLTAVQYEDVLGEVSQANMPGIT
DGYPNWRRKLDRDLDAIAAPGGPLAKLAASLASEDRGPRSGAARLASEPPRATYRLQFHK
DFTFDDAVGILPYLAKLGISHVYASPIHKARPGSTHGYDIVDHREINPELGGEAAFIRFS
DALKAHGLKLLLDIVPNHMGVGGADNPWWLSVLEWGALSPASEAFDIDWERIGAHNKLVV
PFLGDRYGEALEKGDLKLTFDPAEGGFSVWHHEHKFPICPLSYPIVLDRALAALPEAGDE
PSAEVLAISERLRRMSEETDPERLAGFPAEADGLKHRLAEAVKSSPELQQAIDRAVALVN
GFKGHPDSFGALHRILEAQSYRLAHWRVAASDINYRRFFDVNSLAGLRVERPAVFEGAHA
MLFRQIRAGRIDGLRIDHIDGLADPAGYVRALQEAVGPGFYIVVEKILEPGERLRPWLVA
GTTGYDVLNQIDGLFVDRDKREAVRAFYAEATGTDEPYGVLLRQVKAEILETSFASELEV
LTSDLKRVADADRRTRDFSVNALRQALTEIVARFPVYRSYMPQDLDGDELEAEDVRLIEG
AVRKAKRHSRLPDRSVHDFAQSVLLGRIDTDSPGRPSPEIVRRVRRRFQQLTGPVMAKSL
EDTLFYRFVELLALNEVGGDPGEYGLTAEHFHALQAARARDWPNALITTATHDTKRGEDA
RARLLALSAMPELWQAEWARWREIAEPHLTELEGEPAPDANDQWMFFQAILGAWPLDLLD
DVSDAGTVEAFRQRLGAYAEKALRESKRWSSWVNIDEAYEGAVAGLFDALIAPGSEFLTA
FRPFARRLAEAGMVTGLARTVLKCTLPGLPDTYQGTEFWDFSFVDPDNRRPVDYAARARA
LAEDGPIDEMLAQWPDGRIKQAVLARLLADRAAEPTFYADADYRPVEAEGSRARQLLAFI
RGEAATGGELLVVVPRQVADLAGDLPRFGEAFFGTVLPVQEGSRWRDLVTGQELGPEGGR
LPVDRLFRRLPLAVLRRLTASS
NT seq 4929 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgtccgaggatgtcgtcgcgcggctcgcccggctcgcgggcctcgccgccgac
tacgtcgatgccttcggcagcccaatcgagacgcccctcgacgcccggcgcggcgtgctc
gctgccctgggcctgccctccggcaccgaggaggaggcccgctcaagcctcgcgcggatc
gaggccctgcgccatggcctggtgccgccgctggtgccggtcgaggccaggcgcgcctcg
cgggtgcccgtgcgggcggaccgcaacgggaccctgaactggcgcgtcgtcgacgagcgc
ggcagcgcgcgggacggccgcgccccgatcgctctcgggggcgggacacccgccttcgac
ctgccgccgctgactccgggctatcaccgcctcaccgtgacgctgggtgacaagcgcgcc
gaggcgaccgtgatcgccgcgccccagcgctgctggcgcccgcgggcgctcggcgaggag
ggcgcccgggactggggcctcgccgtgcagctctacggcctgcgctcggccgagaatctc
ggcatcggcacctacacggatgcgggccgggcggcgaccgacgcgggcgcgcggggcgcg
gccttcctggggctcagtcccgtccacgcgctgtttccgagcgaccggcacaaggtctcg
ccctattcgccctcctcgcggctcttcctcgaaaccctctacatcgacccgcaggcggtg
ccgggcttcgccggcagccgggccgcttccctcctcgacgcgatgcgcccgcaggtggag
cggctgcgggaagccgccctcgtcgaccatgctggcgtctgggaggtgctggggccggtc
ctcgacgccctctggcaggaatcccgcgcccgggccgggcaggatacggagttcctggcc
ttccgcgccgcgggtggcgagagcctcgaagcgcacgcgaccttcgatgccctgtccgag
catttccgccgccagggggcgtcctggctcggcgagtggccggaggaataccgccgcaac
ggcacgccggcggttctggccttcgcggcggagcaccctgagcgcatcgcctactacgcg
tggctgcagttcatcgccgaccggcagctcgcggcggcggccgccgccgcgcaggccgcc
ggcatgcggctcggcctctaccgcgaccttgcggtcggggccgaccggggcgggtccgag
gtctggtcgaaccctgagcgcttcgccaccggcctgtccatcggcgcgccgccggacctc
ctcgccccgaacggccaggattggggtctgccgcccttcgatcccctcgaactggagcgg
gacgggctcgcggccttccgggcgctggttcaggccaatatgcgccacgcgggcgcgatc
cgcatcgaccacgccttccagctcgccaggctctacctgatcccggcggggcagggggcg
aaggcgggcgcctatgtggcgatgcccttcgagccgatgctggcggtgctgcggctcgag
agccaccgggcgaagtgcctcgtcatcgccgaggatctcggcacggcgccgcagggcttc
tccgacgcgctgatgcaggcgggcatcctgagctaccgcatcctcgccttcgagcggggc
gagggcggctcgttcaagagcccggaggcctatccgcgcgacgcgctctgcgccatcacc
acgcacgacctgccgaccttcgtcggctggtggcggggggtcgacacggatctgcgccag
tcgctgggcctctacgacggcgagcgggcggatgcggagcgggccgagcgcgtgaccgag
cggcggcgcctcaccgaggcgctccacagcgagaacctgcagccgggcgcggagcccccg
gaccagccgcccttcgatgcggcggcccgctatctcgcccgcgccccctcggtgctcacc
gccgtgcagtacgaggacgtgctcggcgaggtgagccaggccaacatgccgggcatcacc
gacggctacccgaactggcgccgcaagctcgaccgggacctcgatgccatcgcggcgccg
ggcgggccgctcgccaagctcgccgcttcgctcgcctcggaggatcgcggcccgcgctcg
ggcgccgcgcgcctcgcctccgagccgccgcgggcgacctaccgcctgcagttccacaag
gacttcaccttcgacgacgcggtcggcatcctgccctacctcgcgaagctcgggatcagc
cacgtctacgcctcgccgatccacaaggcccggcccggctcgacccatggctacgacatc
gtcgaccaccgcgagatcaatccggagctcggcggcgaggcggccttcatccgcttcagc
gacgccctgaaggcgcacgggctgaagctcctcctcgacatcgtgcccaaccacatgggc
gtgggcggcgccgacaatccctggtggctctcggtcctcgaatggggagcgctctcgccc
gcctccgaggccttcgacatcgactgggagcgaatcggcgcgcacaacaagctcgtggtg
ccgttcctgggcgaccgctacggcgaggccctggagaagggcgacctcaagctcaccttc
gatccggccgagggcggcttctcggtctggcaccacgagcacaagttcccgatctgcccc
ttgagctatccgatcgtgctcgaccgggcgctggcggccctgccggaggccggcgacgag
ccctccgccgaggtgctggcgatctccgagcgcctgcgccgcatgagcgaggagacggat
ccggagcgcctcgccggcttcccggcggaggccgacgggctcaagcaccgcctcgccgag
gcggtgaagtcctcgcccgagctgcagcaggcgatcgaccgcgccgtggcgctggtgaac
ggcttcaagggccatcccgacagcttcggggcgctccaccgcatcctggaggcgcaatcc
taccggctcgcccattggcgggtcgcggcgagcgacatcaactaccgccgcttcttcgac
gtgaattccctcgcgggcctgcgcgtcgagcgcccggcggtgttcgagggcgcgcatgcg
atgctcttccgccagatccgggcggggcggatcgacggattgcgcatcgaccacatcgac
ggcctcgccgatccggccggctacgtgcgggcgctgcaggaggcggtcggccccggcttc
tacatcgtggtcgagaagatcctggagccgggcgagcggctgcggccctggctcgtcgcc
ggcaccaccggctacgacgtgctcaaccagatcgacgggctgttcgtcgaccgcgacaag
cgcgaggcggtgcgcgccttctacgcggaggcgaccgggaccgacgagccctatggcgtg
ctcctgcggcaggtgaaggcggagatcctggagacgagcttcgcgagcgagctcgaggtc
ctcacctccgacctcaagcgcgtggccgatgccgaccggcgcacccgcgacttctcggtc
aacgcgctgcgccaagccctcacggagatcgtggcgcgcttccccgtctatcgcagctac
atgccccaggacctcgacggggacgagctggaggccgaggacgtgcggctgatcgagggg
gcggtgcgcaaggccaagcgccattcgcgcctgcccgaccgctcggtccacgacttcgcc
cagagcgtgctcctcgggcgcatcgacacggatagtccgggccggccctcgcccgagatc
gtgcgccgcgtgcgccgccgcttccagcagctcaccggccccgtgatggcgaagagcctg
gaggacaccctgttctaccgcttcgtcgagctcctggcgctgaacgaggtgggcggcgat
cccggcgagtacggcctcaccgcggagcatttccacgccctccaggcggcccgcgcccgc
gactggccgaatgcgctgatcaccacggcgacgcacgacaccaagcgcggcgaggatgcc
cgcgcgcgcctcctcgcgctctcggccatgcccgagctctggcaggccgaatgggcgcgc
tggcgggagatcgccgagccgcatctcaccgaactcgagggcgagcccgcccccgacgcc
aacgaccagtggatgttcttccaggcgatcctgggcgcttggcccctcgacctcctcgac
gacgtctcggacgcaggcacggtcgaggcgttccgccagcgcctcggcgcctatgcggag
aaggccctgcgcgagagcaagcgctggtcgagctgggtcaacatcgacgaggcctacgag
ggcgcggtggccgggctgttcgatgcgctcatcgcgccgggctccgaattcctcaccgcc
ttccggcccttcgcgcgccgcctcgccgaggccgggatggtgaccgggctcgcccgcacg
gtgctcaaatgcacgctgccgggtctgcccgacacctaccagggcaccgagttctgggac
ttctccttcgtcgatcccgacaaccggcggcccgtcgactatgcggcccgggcgcgcgcg
ctggcggaggatggccccatcgacgagatgctggcgcaatggccggacgggcggatcaag
caggcggtcctggcgcggctcctcgccgaccgcgcggccgagcccaccttctacgccgat
gccgattaccgcccggtcgaggcggaggggtcgcgggcgcgccagctgctcgccttcatc
cgcggcgaggccgccacgggcggcgaactcctcgtcgtcgtgccgcggcaggtggcagat
ctggccggggacctgccccgcttcggagaggcttttttcggtaccgtgctccccgtacag
gagggcagccgctggcgcgatctcgtcaccggacaggaactcgggcccgagggcgggcgt
cttccggtcgaccgcctcttccggaggctccccctcgcggttctgcgacggctgaccgcg
tcgagttag

DBGET integrated database retrieval system