KEGG   Methylobacterium nodulans: Mnod_7569Help
Entry
Mnod_7569         CDS       T00839                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mno  Methylobacterium nodulans
Pathway
mno00071  Fatty acid degradation
mno00280  Valine, leucine and isoleucine degradation
mno00281  Geraniol degradation
mno00310  Lysine degradation
mno00360  Phenylalanine metabolism
mno00362  Benzoate degradation
mno00380  Tryptophan metabolism
mno00410  beta-Alanine metabolism
mno00627  Aminobenzoate degradation
mno00640  Propanoate metabolism
mno00650  Butanoate metabolism
mno00903  Limonene and pinene degradation
mno00930  Caprolactam degradation
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
mno01130  Biosynthesis of antibiotics
mno01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mnod_7569
   00650 Butanoate metabolism
    Mnod_7569
  Lipid metabolism
   00071 Fatty acid degradation
    Mnod_7569
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mnod_7569
   00310 Lysine degradation
    Mnod_7569
   00360 Phenylalanine metabolism
    Mnod_7569
   00380 Tryptophan metabolism
    Mnod_7569
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mnod_7569
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mnod_7569
   00281 Geraniol degradation
    Mnod_7569
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mnod_7569
   00627 Aminobenzoate degradation
    Mnod_7569
   00930 Caprolactam degradation
    Mnod_7569
Enzymes [BR:mno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mnod_7569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ACL62305
JGI: Mnod7569
UniProt: B8IPL3
Position
complement(7678711..7679769)
Genome map
AA seq 352 aa AA seqDB search
MTGDASDEVLVERRGAAGLLTLNRPKALNALDLGMVRRLRAALDAWGEDPGVTRIVLRGT
GRAFCAGGDLRRIHDIAKAAGPAAVDVFWREEYALNTLIHRYPKPIVSLIDGIVMGGGVG
LSLHGSNRVAGERYAFAMPEVSIGFFPDVGATYALPRLPGAFGTYLALTGERVGPGDGLA
FGLATHAVPAASFEAITETLAAGGPVEEALEQAPGHDAPPPGPLHAARALIDACFSAESV
AAVLARLDAAAAQGSDFAARTAATIRTRSPTSLAVAFAQMRRGGSMSFPEAMLTEYRIVT
RILQGHDFYEGVRAVIIDKHGAPRWQPDSLDAVAPAAVEAYFAPLPDEPRFG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgacgcttcggacgaggtgctggtcgagcggcggggcgctgcggggctcctg
acgctcaaccggccgaaggcgctcaacgcgctcgatctcggcatggtccgccggctccgt
gcggcgctcgatgcctggggcgaggatcccggcgtcacccggatcgtgctgcgcgggacc
ggacgggccttctgtgcgggcggcgacctccgccgcatccacgacatcgcgaaggccgcc
ggccccgccgcggtcgacgtgttctggcgcgaggaatatgccctcaacacgctgatccac
cgctacccgaagccgatcgtctcgctcatcgacggcatcgtgatgggcggcggcgtcggc
ctgtcgctgcacggctcgaaccgcgtcgcgggcgagcgctacgccttcgcgatgccggag
gtcagcatcggcttcttccccgatgtcggcgcgacttacgcgctgccgcggctgccgggg
gccttcggcacctatctggcgctcacgggcgagcgggtggggccgggggatggcctcgcc
ttcgggctcgccacccacgcggtgccggccgcgtccttcgaggcgatcaccgaaaccctc
gcggcgggcggcccggtcgaggaggcgctggagcaggcgccggggcacgacgcgccgccg
cccggcccgctccatgccgcgcgcgcgctcatcgacgcctgcttctcggccgagagcgtc
gccgcggtgctggcccggctcgatgccgcagcggcgcaggggtcggacttcgccgccagg
accgccgccaccatccgcacccgctcgcccacgagcctcgcagtcgccttcgcgcagatg
cgccgcggcggctccatgagcttcccggaggcgatgctcaccgagtaccggatcgtcacc
cgcatcctgcagggccacgacttctacgagggcgtgcgcgccgtgatcattgacaagcat
ggcgcgccgcgctggcagcccgacagcctcgacgcggtggcgccggcggcggtggaagcc
tatttcgcgccgctgcccgacgagccgcggttcggctga

DBGET integrated database retrieval system