KEGG   Methylobacterium nodulans: Mnod_7570Help
Entry
Mnod_7570         CDS       T00839                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mno  Methylobacterium nodulans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mno00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7679967..7681019
Genome map
AA seq 350 aa AA seqDB search
MLQIQPLAGPLARDAARTQAAPGLTLAQRPRRNRKAEWSRRLVRETVLTVDDLIWPLFLI
EGERRREPVASMPGVERLSVDEAVREAERAAALKIPAISFFPYVDPTLRDETGSEALNRN
NLVCRAVRAVKAAVPEIGVITDVALDPYTSHGHDGLLDDTVIVNDATVALLVEQSLVQAE
AGTDVIAPSDMMDGRVGAIRAGLDKAGFRDVQIMAYAAKYASAFYGPFRDAIGTSATLKG
DKRTYQMDPGNSEEALREVALDLEEGADSVMVKPGLPYLDIIRRVKDGFGVPTFAYQVSG
EYAMIAAAAQNGWLDGERAMIESLMAFKRAGADGVFTYFALQVAERLRAG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgctccagatccagcccttggccggtcccctcgcgcgcgacgccgcccggacgcaggcc
gcgcccggcctcaccctggcgcagcgcccgcggcgcaaccgcaaggcggagtggtcgcgc
cggctcgtgcgcgagacggtgctcaccgtcgacgacctgatctggccgctcttcctcatc
gagggcgagcgccgccgcgagcccgtcgcctcgatgccgggcgtcgagcgcctgagcgtc
gacgaggcggtgcgggaggccgagcgcgccgccgcgctcaagatcccggcgatctcgttc
tttccctatgtcgaccctaccttacgcgacgagaccggctccgaggcgctcaaccgcaac
aatctcgtctgccgggccgtgcgggccgtgaaggcggccgtgccggagatcggcgtcatc
acggacgtcgccctcgacccctataccagccacgggcatgacggcctcctcgacgacacc
gtgatcgtgaacgatgcgacggtggcactcctcgtcgagcagagcctcgtccaggcggag
gccggcaccgacgtgatcgccccctccgacatgatggacgggcgcgtgggcgcgatccgg
gccgggctcgacaaggccgggttccgggacgtgcagatcatggcctatgcggccaagtat
gcgagcgcgttctacggtccgttccgcgacgcgatcggcaccagcgccaccctcaagggc
gacaagcgcacctaccagatggatccgggcaattccgaggaggccctgcgcgaggtcgcc
ctcgatctcgaggagggtgccgattccgtgatggtgaagcccggcctgccctatctcgac
atcatccgccgggtgaaggacgggttcggcgtgccgaccttcgcctatcaggtctccggc
gaatacgcgatgatcgccgccgcggcgcagaacggctggctcgacggcgagcgcgccatg
atcgagagtctgatggccttcaagcgcgcgggggcggacggcgtcttcacctacttcgcg
ctccaggtggcggagcggctgcgggcggggtga

DBGET integrated database retrieval system