KEGG   Methylobacterium nodulans: Mnod_7570Help
Entry
Mnod_7570         CDS       T00839                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mno  Methylobacterium nodulans
Pathway
mno00860  Porphyrin and chlorophyll metabolism
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
Module
mno_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mnod_7570
Enzymes [BR:mno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mnod_7570
Exosome [BR:mno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mnod_7570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACL62306
JGI: Mnod7570
UniProt: B8IPL4
Position
7679967..7681019
Genome map
AA seq 350 aa AA seqDB search
MLQIQPLAGPLARDAARTQAAPGLTLAQRPRRNRKAEWSRRLVRETVLTVDDLIWPLFLI
EGERRREPVASMPGVERLSVDEAVREAERAAALKIPAISFFPYVDPTLRDETGSEALNRN
NLVCRAVRAVKAAVPEIGVITDVALDPYTSHGHDGLLDDTVIVNDATVALLVEQSLVQAE
AGTDVIAPSDMMDGRVGAIRAGLDKAGFRDVQIMAYAAKYASAFYGPFRDAIGTSATLKG
DKRTYQMDPGNSEEALREVALDLEEGADSVMVKPGLPYLDIIRRVKDGFGVPTFAYQVSG
EYAMIAAAAQNGWLDGERAMIESLMAFKRAGADGVFTYFALQVAERLRAG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgctccagatccagcccttggccggtcccctcgcgcgcgacgccgcccggacgcaggcc
gcgcccggcctcaccctggcgcagcgcccgcggcgcaaccgcaaggcggagtggtcgcgc
cggctcgtgcgcgagacggtgctcaccgtcgacgacctgatctggccgctcttcctcatc
gagggcgagcgccgccgcgagcccgtcgcctcgatgccgggcgtcgagcgcctgagcgtc
gacgaggcggtgcgggaggccgagcgcgccgccgcgctcaagatcccggcgatctcgttc
tttccctatgtcgaccctaccttacgcgacgagaccggctccgaggcgctcaaccgcaac
aatctcgtctgccgggccgtgcgggccgtgaaggcggccgtgccggagatcggcgtcatc
acggacgtcgccctcgacccctataccagccacgggcatgacggcctcctcgacgacacc
gtgatcgtgaacgatgcgacggtggcactcctcgtcgagcagagcctcgtccaggcggag
gccggcaccgacgtgatcgccccctccgacatgatggacgggcgcgtgggcgcgatccgg
gccgggctcgacaaggccgggttccgggacgtgcagatcatggcctatgcggccaagtat
gcgagcgcgttctacggtccgttccgcgacgcgatcggcaccagcgccaccctcaagggc
gacaagcgcacctaccagatggatccgggcaattccgaggaggccctgcgcgaggtcgcc
ctcgatctcgaggagggtgccgattccgtgatggtgaagcccggcctgccctatctcgac
atcatccgccgggtgaaggacgggttcggcgtgccgaccttcgcctatcaggtctccggc
gaatacgcgatgatcgccgccgcggcgcagaacggctggctcgacggcgagcgcgccatg
atcgagagtctgatggccttcaagcgcgcgggggcggacggcgtcttcacctacttcgcg
ctccaggtggcggagcggctgcgggcggggtga

DBGET integrated database retrieval system