KEGG   Methylobacterium nodulans: Mnod_7678Help
Entry
Mnod_7678         CDS       T00839                                 

Definition
agmatinase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
mno  Methylobacterium nodulans
Brite
Enzymes [BR:mno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     Mnod_7678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7770631..7771635
Genome map
AA seq 334 aa AA seqDB search
MTRPDDDPTRAARLARFQPLSGMAMPRFAGLASLMRLPVLTPKEAVAEPIDIGLFGIPFD
SATTNRPGARLGPRGVREQSALMRLVNHATGVCPYELCACADLGDVPVNPADVVDTLARI
EAFTAPLHAAGLTLLAIGGDHLVTYPLLRTLGRDAPVGLIHIDAHSDTTDSYFGGAKLTH
GTPFRRAIEDGVLDPKRSVQIGIRGTLYARDERRWALDQGIRIIEMERVIAQGLPAVVTE
ARAVVGAGPTYLSFDIDSIDPAFAPGTGTPEIGGFTSREALFLVRGLRGLDLVGADVVEV
APPLDPSGTTALVGATFAFELLCLLAEARARRRG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcccggacgacgacccgacccgcgcggcgcgcctcgcgcgcttccagccgctg
tccggcatggcgatgccgcgtttcgcggggctcgccagcctgatgcgcctgccggtgctg
acgcctaaggaggccgtcgccgagccgatcgatatcggcctcttcggcatccccttcgac
agcgccaccacgaaccggccgggggcacggctcgggccgcggggcgtgcgcgagcaatcg
gccctgatgcgcctcgtcaaccacgccacgggcgtgtgcccctacgaactctgcgcctgc
gcggatctcggcgacgtgccggtcaatcccgccgacgttgtcgacacgctggcgcgtatc
gaggccttcacggcgccgctgcacgcggccggcctgaccctgctcgccattggcggcgac
cacctcgtcacctatccgctgctgcgcacgctgggccgggacgcacccgtggggctcatc
cacatcgacgcgcacagcgacacgacggacagctatttcggcggcgccaagctcacccac
ggcaccccgttccgccgggccatcgaggatggcgtgctcgatccgaagcgcagcgtgcag
atcggcattcgcggcacgctctacgcccgggacgagcgccgatgggccctcgatcagggc
atccgcatcatcgagatggagcgcgtcatcgcgcagggcctgcccgccgtggtgaccgag
gcccgggcggtggtcggcgccgggccgacctacctgagcttcgacatcgactcgatcgat
cccgccttcgcccccggcaccggcacgcccgagatcggtggcttcacctcgcgcgaggcg
ctgttcctggtccgggggctgcgcggcctcgatctcgtgggggccgacgtggtggaggtc
gccccgcccctcgacccctccggcaccaccgcgctcgtcggcgcgaccttcgccttcgag
ctgctgtgcctgctcgccgaggcgcgggcgcggcgccggggctga

DBGET integrated database retrieval system