KEGG   Methylobacterium nodulans: Mnod_8088Help
Entry
Mnod_8088         CDS       T00839                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mno  Methylobacterium nodulans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Module
Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mno00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mno00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pMNOD02:complement(310729..311562)
Genome map
AA seq 277 aa AA seqDB search
MVRILQSAGLDRTGTARPLDGRVAIVTGSTSGIGLAIANTLAEQGALIVINGLGDEAEIE
RLCRELSDRHQTPVRYDDADLSQAGAVMDLVDRSARAFGPVEILVNNAGIQYVSPIEEFP
PEKWDAILAINLSAVFHATRCVLPDMRRRGWGRIINVASAHGLIGSPFKSAYVAAKHGVI
GLTKVTALEMAEAGITCNAVCPGYVWTPLVEHQVRAQAVAHGISEDEVVRKVLLAEQPNK
RFATAEEIAGTVAFLCSPAAASITGASISVDGGWTAH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggtacgcatcctccagtcggccgggctcgaccggaccgggacggcgcgaccgctcgac
ggccgcgtcgccatcgtgaccgggtccacgagcggcatcgggctcgcgatagccaacacc
ttggctgagcagggcgcgttgatcgtgatcaatggtctgggcgacgaggccgagatcgag
cgtctctgccgagagctgagcgaccggcaccagacgcccgtccgttacgacgacgccgac
ctctcgcaggccggcgccgtcatggacctcgtcgaccgctcggcgcgtgccttcggcccc
gtcgagatcctcgtgaacaatgccggtatccagtacgtcagccccatcgaggagttcccg
cccgagaagtgggacgccattctggcgatcaacctgtccgcggtgttccacgccacgcgc
tgcgtcctgcccgacatgcgccggcgcggctggggccggatcatcaacgtggcctcggcg
cacgggctgatcggctcgcccttcaagagcgcctatgtggcggccaagcacggggtcatc
ggcctgaccaaggtcaccgcgcttgagatggccgaggccggcatcacctgcaacgcggtc
tgccccggctacgtctggacgccgctcgtcgagcatcaggtgcgcgcccaggcggtcgcg
cacggcatctcggaggacgaggtggtccgaaaggtcctcctcgccgagcagccgaacaag
cgcttcgccacggcggaggagatcgccgggacggtcgcgttcctgtgcagcccggccgcg
gcctccatcaccggcgcgtccatcagcgtcgatggcggctggacggcccattga

DBGET integrated database retrieval system