KEGG   Methylobacterium nodulans: Mnod_8088Help
Entry
Mnod_8088         CDS       T00839                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mno  Methylobacterium nodulans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Module
Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mnod_8088
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mnod_8088
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mnod_8088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pMNOD02:complement(310729..311562)
Genome map
AA seq 277 aa AA seqDB search
MVRILQSAGLDRTGTARPLDGRVAIVTGSTSGIGLAIANTLAEQGALIVINGLGDEAEIE
RLCRELSDRHQTPVRYDDADLSQAGAVMDLVDRSARAFGPVEILVNNAGIQYVSPIEEFP
PEKWDAILAINLSAVFHATRCVLPDMRRRGWGRIINVASAHGLIGSPFKSAYVAAKHGVI
GLTKVTALEMAEAGITCNAVCPGYVWTPLVEHQVRAQAVAHGISEDEVVRKVLLAEQPNK
RFATAEEIAGTVAFLCSPAAASITGASISVDGGWTAH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggtacgcatcctccagtcggccgggctcgaccggaccgggacggcgcgaccgctcgac
ggccgcgtcgccatcgtgaccgggtccacgagcggcatcgggctcgcgatagccaacacc
ttggctgagcagggcgcgttgatcgtgatcaatggtctgggcgacgaggccgagatcgag
cgtctctgccgagagctgagcgaccggcaccagacgcccgtccgttacgacgacgccgac
ctctcgcaggccggcgccgtcatggacctcgtcgaccgctcggcgcgtgccttcggcccc
gtcgagatcctcgtgaacaatgccggtatccagtacgtcagccccatcgaggagttcccg
cccgagaagtgggacgccattctggcgatcaacctgtccgcggtgttccacgccacgcgc
tgcgtcctgcccgacatgcgccggcgcggctggggccggatcatcaacgtggcctcggcg
cacgggctgatcggctcgcccttcaagagcgcctatgtggcggccaagcacggggtcatc
ggcctgaccaaggtcaccgcgcttgagatggccgaggccggcatcacctgcaacgcggtc
tgccccggctacgtctggacgccgctcgtcgagcatcaggtgcgcgcccaggcggtcgcg
cacggcatctcggaggacgaggtggtccgaaaggtcctcctcgccgagcagccgaacaag
cgcttcgccacggcggaggagatcgccgggacggtcgcgttcctgtgcagcccggccgcg
gcctccatcaccggcgcgtccatcagcgtcgatggcggctggacggcccattga

DBGET integrated database retrieval system