KEGG   Methylobacterium nodulans: Mnod_8717Help
Entry
Mnod_8717         CDS       T00839                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mno  Methylobacterium nodulans
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mno00030]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:mno00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pMNOD01:complement(451339..453840)
Genome map
AA seq 833 aa AA seqDB search
MTVLTGSPRNDAHPAQPDARDDFVPGPLGPQELVGLDAYWRAANYLSVGQIYLLDNPLLR
EPLAPAHVKPRLLGHWGTTPGLNFIYAHLNRVIRRRDLDMIAVWGPGHGAPGLVANAYLE
GTYSEVYPDVAPDAEGMRRLFRQFSFPGGIPSHASPELPGSIHEGGELGYSLAHAFGAAL
DNPDLIVACVVGDGEAETGALAASWHSAKFLDPRTDGTVLPILHLNGYKIANPTILARMP
GAELTSLLVGYGYDPIVVAGEETAPMHQAMAAALDRALDRIAQIRREAGCERPRWPMIVL
RSPKGWTGPKVVGGLPVEGTWRSHQVPVAAMRDNPEHLAILERWMRSYHPETLFDAAGRL
MPDLAALAPAGERRLSANPQANGGRHAQPLRRPPIAAHAVAVEAPGAATAEATRVLGAYL
RDVVTLNAASRNFRIMGPDETASNRLDAVLSVTNRVWQEEILPGDDHLARSGRVMEILSE
QLCEGWLEGYLLTGRHGLFASYEAFIHVVDSMVSQHAKWLKSSRALPWRRPVPSLNLLLS
SHVWRQDHNGFSHQDPGFIDFIANKRGDTARVYLPPDANCLLWVMNHCLGTHDRINVVVA
GKQPAPQWLALDAALRHCEAGIGVWDWASSEGEGEPDVVMACAGDVPTMETLAAVDWLRR
VVPDLRVRVVNVVDLMTLPSPDLHPHGLDDATFDGLFTRDRPVVFAYHGYPWLIHRLTYR
RTNHANLHVHGFMEEGTTTTPFDMAVMNRLDRHHLAIAALRRVPRLGARADRAERMLQER
LAVHRAHVCRTGEDLPEIRDWRWPQPGMVKPDEAGARATMGRTGGSTKPAGSP
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcctgacaggatcgcctcggaacgatgcgcaccccgcgcagccggatgcgcgc
gacgacttcgtgccgggtccgctcggcccccaggagctggtgggcctcgatgcctattgg
cgggccgcgaactacctgtcggtcggtcagatctaccttctcgacaacccgctcctgcgc
gagccgctcgcccccgcgcatgtcaagccgcggctgctcggccattggggcaccacgccc
ggcctcaacttcatctacgcccacctgaaccgggtgatccggcggcgcgacctcgacatg
atcgcggtctgggggccgggccacggggcgccggggcttgtcgccaacgcctatctcgaa
ggaacctacagcgaggtctaccccgacgtcgcgccggacgcggagggaatgcgccggctc
ttccgccagttctcgttcccgggcgggattccgagccacgcctcgcccgaactgcccggc
tcgatccacgagggcggagagctcggctactcgctcgcccatgccttcggggccgccctg
gacaatccggacctgatcgtcgcctgcgtggtgggcgacggcgaggccgagacgggggcg
ctcgccgcctcctggcactcggcgaagttcctcgacccgcggacggacggcactgtcctg
ccgatcctccatctcaacggctacaagatcgccaatccgacgatcctggcacgcatgccc
ggggctgagctgacgagcctgctcgtcggctacggctacgatccaatcgtcgtcgccggc
gaggagacggcgccgatgcatcaggcgatggcggcggcgctcgaccgcgcgctcgaccgc
atcgcgcaaatccggcgcgaggccggctgcgagcggccgcgctggcccatgatcgtgctg
cgcagcccgaaaggctggaccggcccgaaggtcgtcggcggcctgcccgtcgaggggacg
tggcgctcgcatcaggttccagtggccgccatgcgcgacaacccggagcacctggcgatc
ctcgagcgctggatgcgctcctaccatcccgagaccctgttcgacgccgcgggacgtctt
atgccggacctggccgccctggcgccggcgggcgagcggcggctctccgccaacccgcag
gcgaatggcgggcgccacgcccagccgctccgccggccccccatcgccgctcacgcggtc
gcggtcgaggcgcccggggccgccacggccgaggcgacgcgggtgctcggcgcctatctg
cgcgatgtcgtcaccctcaacgccgcgagccggaacttccggatcatgggtcccgacgag
accgcctcgaaccgcctcgacgccgttctgtccgtgacgaaccgggtctggcaggaggag
atcctgccgggcgacgaccatctcgcccggtccgggcgggtcatggagatcttgagcgag
cagctctgcgagggctggctcgaaggctacctgctgaccggccgccacggcctgttcgcg
agctacgaggccttcatccacgtggtcgactcgatggtgagccagcacgccaagtggctc
aaatcctcccgcgcgctgccctggcgccggccggtcccgtcgctgaacctcctgctgtcc
tcccatgtctggcgccaggaccacaacggattcagccatcaggatcccggcttcatcgac
ttcatcgccaacaagcgcggcgacacggctcgggtctacctgccgccggacgccaattgc
ctgctgtgggtgatgaatcactgcctgggcacgcatgaccgcatcaacgtggtcgtggcc
ggcaagcagcccgcgccccaatggctcgctctcgacgcagctttgcgccattgcgaggcg
ggcatcggcgtctgggactgggcctcgtccgaaggggagggcgagcccgacgtggtgatg
gcctgcgcgggcgacgtgcccacgatggagaccctggcagcggtggactggctgcgccgg
gtcgttcccgatctacgggtgcgggtggtgaacgtcgtcgacctgatgacgctgccctcg
cccgacctccacccgcacgggctcgacgatgcgaccttcgacggcctgttcacgcgggac
cgcccggtggtgttcgcctatcacggttatccctggctgatccatcggctgacctaccgg
cgcaccaaccacgcgaacctgcatgtgcacggtttcatggaggagggcacgacgacgacg
cccttcgacatggctgtgatgaaccgtctcgaccgtcaccatctcgcgatcgcagccttg
cgtcgggtgccgcgcctcggcgcccgggcggaccgcgccgagcgcatgctgcaggagcgg
ctcgccgtccatcgcgcgcatgtctgtcggaccggcgaggacctgccggagatccgggac
tggcgctggccgcagccgggcatggtgaagccggacgaggcgggcgcccgcgcaaccatg
gggcggaccggggggagcacgaagccggctggcagtccatga

DBGET integrated database retrieval system