KEGG   Methanothermococcus okinawensis: Metok_0107Help
Entry
Metok_0107        CDS       T01534                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mok  Methanothermococcus okinawensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mok00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97944..98789
Genome map
AA seq 281 aa AA seqDB search
MYFEDFSKYICAYSDFEDADFAIFGIPYDATTSYKPGTRFGPDEIRKASWGLETYSPVLK
KDLTDIALCDLYNIIIEGAQDEIIRRSYRASKNIMKKGKVPIMMGGEHSITYPVVKAVKD
TYEDFILIQFDAHCDLRDEYLGNKYSHASVIRRCFDLTNNIYQFGIRSGDKEEWEFGMEN
TKISTDLPKKDDIKEIKSLDKPVYITIDIDVLDPAYAPGTGTPEPCGFSTKELITSLYLF
EELKDNIVGFDVVEVSPHYDINDITSIAAAKIIRELMLTIS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgtattttgaggatttttctaaatatatatgtgcctattctgattttgaagatgcggat
tttgcaatatttggaataccttatgatgctacaacatcttacaaacctggaacaagattt
ggacctgatgaaataagaaaggcgtcttggggattggaaacatatagtcctgtcttaaaa
aaggatttaacagacatcgcgttatgtgatttatacaatataatcattgaaggagctcag
gatgaaattattaggaggtcatatagggcctctaaaaatattatgaaaaaaggtaaagta
cctataatgatgggaggggagcattcaataacttatccagtagtaaaggctgtaaaagat
acatatgaggattttattttaatacaatttgatgctcattgtgatttaagggatgagtat
ttgggtaataaatattctcatgcaagtgtgataaggagatgtttcgatttaacaaataat
atatatcaatttgggataagaagcggagataaagaggaatgggaatttggaatggagaat
acaaaaatatccacagatttacctaaaaaggatgatataaaagaaattaaatctttggat
aaacctgtgtatatcacaatagacatcgatgttttagaccctgcatacgccccaggaaca
gggactcctgaaccatgcggattttctacaaaggaattaataacttcactctatttattt
gaagaattaaaggataatattgtaggttttgatgttgtagaagtatctccacattatgat
ataaacgatattacatctattgctgcggcaaagataataagggagctcatgctgacaata
tcataa

DBGET integrated database retrieval system