KEGG   Methanothermococcus okinawensis: Metok_0107Help
Entry
Metok_0107        CDS       T01534                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mok  Methanothermococcus okinawensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Metok_0107
Enzymes [BR:mok01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Metok_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97944..98789
Genome map
AA seq 281 aa AA seqDB search
MYFEDFSKYICAYSDFEDADFAIFGIPYDATTSYKPGTRFGPDEIRKASWGLETYSPVLK
KDLTDIALCDLYNIIIEGAQDEIIRRSYRASKNIMKKGKVPIMMGGEHSITYPVVKAVKD
TYEDFILIQFDAHCDLRDEYLGNKYSHASVIRRCFDLTNNIYQFGIRSGDKEEWEFGMEN
TKISTDLPKKDDIKEIKSLDKPVYITIDIDVLDPAYAPGTGTPEPCGFSTKELITSLYLF
EELKDNIVGFDVVEVSPHYDINDITSIAAAKIIRELMLTIS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgtattttgaggatttttctaaatatatatgtgcctattctgattttgaagatgcggat
tttgcaatatttggaataccttatgatgctacaacatcttacaaacctggaacaagattt
ggacctgatgaaataagaaaggcgtcttggggattggaaacatatagtcctgtcttaaaa
aaggatttaacagacatcgcgttatgtgatttatacaatataatcattgaaggagctcag
gatgaaattattaggaggtcatatagggcctctaaaaatattatgaaaaaaggtaaagta
cctataatgatgggaggggagcattcaataacttatccagtagtaaaggctgtaaaagat
acatatgaggattttattttaatacaatttgatgctcattgtgatttaagggatgagtat
ttgggtaataaatattctcatgcaagtgtgataaggagatgtttcgatttaacaaataat
atatatcaatttgggataagaagcggagataaagaggaatgggaatttggaatggagaat
acaaaaatatccacagatttacctaaaaaggatgatataaaagaaattaaatctttggat
aaacctgtgtatatcacaatagacatcgatgttttagaccctgcatacgccccaggaaca
gggactcctgaaccatgcggattttctacaaaggaattaataacttcactctatttattt
gaagaattaaaggataatattgtaggttttgatgttgtagaagtatctccacattatgat
ataaacgatattacatctattgctgcggcaaagataataagggagctcatgctgacaata
tcataa

DBGET integrated database retrieval system