KEGG   Methanothermococcus okinawensis: Metok_0122Help
Entry
Metok_0122        CDS       T01534                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00260  Glycine, serine and threonine metabolism
mok00750  Vitamin B6 metabolism
mok01100  Metabolic pathways
mok01110  Biosynthesis of secondary metabolites
mok01120  Microbial metabolism in diverse environments
mok01230  Biosynthesis of amino acids
Module
mok_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metok_0122
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metok_0122
Enzymes [BR:mok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metok_0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP C1_2
Motif
Other DBs
NCBI-ProteinID: AEH06118
UniProt: F8AMZ5
Position
complement(115946..117163)
Genome map
AA seq 405 aa AA seqDB search
MIQKCIVCGKEYDIDDIRYTCECGGLLEIKYDYESIKEKVSKESLRKREIGVWRYLDYLP
VKDPKKIVTLHEGGTPLYKCDNLAKELGLKELYVKNEGANPTGSFKDRGMTMGVTRANEL
GVNIVGCASTGNTSASLAAYSARSNKKCIVLLPSGNVALGKLAQAMFYGAKVIQINGNFD
DALLMVRKLAEEGKLYLLNSVNPFRLEGQKTIGFEICDQLNWEVPDRVILPVGNAGNISA
IWKGFKEFKETGITDKLPKMTGIQAEGAKPIVEAFKKGQKTIVPEKHPETIATAIRIGNP
VNYPKALDAIYSSGGLAESVTDEEIVEAQKLLARKEGIFVEPASAASIAGLIKLIEMDAI
DRDEKIVCITTGHGLKDPDAAIRASERPIEIECDMDVLHSIINEE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaatgtatagtatgtggaaaagaatatgatatagacgatataagatataca
tgcgaatgtggaggattattagaaattaaatacgactatgaatccataaaagaaaaggta
tccaaagaaagcctaagaaaaagagaaattggagtttggagatatttagactatcttcca
gtaaaagacccaaaaaaaatagttacgcttcatgaaggagggactccattatataaatgt
gataaccttgccaaggagctcggcttgaaggagctctatgtgaaaaatgaaggggctaac
ccaacaggtagttttaaagatagaggcatgacaatgggcgttactagggcaaacgaattg
ggagtgaatattgttggatgtgcctccacaggaaatacctctgcatcacttgcagcatat
tctgcaaggtccaataaaaaatgtattgtgttgttgccaagtggaaatgttgcacttgga
aaattagcacaggctatgttttatggtgcaaaagttatccaaataaatggaaattttgat
gatgccttattgatggtaagaaaacttgccgaagaaggaaaattgtatttattaaactcg
gtaaatccattcagattggaagggcagaaaaccatagggttcgaaatttgtgaccaactt
aattgggaagttcccgacagagttatacttccagtaggaaatgcagggaatataagtgca
atatggaaaggatttaaagaatttaaggaaacaggcataactgataaacttccaaaaatg
acaggtattcaagccgaaggtgcaaagccaatagttgaagcatttaaaaaaggacagaaa
accatagtcccagaaaagcatcctgaaacaatagcaaccgccataagaataggaaatcct
gtaaattatccaaaagcactcgatgcaatatattcatcaggaggtcttgcagaaagtgta
actgatgaagagatagtagaagctcagaaacttcttgcaagaaaagaaggaatattcgtt
gaaccggcatcggcagcatcaatagcaggacttataaaattaattgaaatggatgctatc
gatagggatgaaaaaatcgtatgtattacaacaggacatgggttaaaagaccctgatgct
gcaataagagcaagcgaaagacctattgaaattgaatgcgatatggatgtccttcacagt
ataataaacgaagaataa

DBGET integrated database retrieval system