KEGG   Methanothermococcus okinawensis: Metok_0129Help
Entry
Metok_0129        CDS       T01534                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00020  Citrate cycle (TCA cycle)
mok00640  Propanoate metabolism
mok00660  C5-Branched dibasic acid metabolism
mok00720  Carbon fixation pathways in prokaryotes
mok01100  Metabolic pathways
mok01110  Biosynthesis of secondary metabolites
mok01120  Microbial metabolism in diverse environments
mok01130  Biosynthesis of antibiotics
mok01200  Carbon metabolism
Module
mok_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metok_0129
   00640 Propanoate metabolism
    Metok_0129
   00660 C5-Branched dibasic acid metabolism
    Metok_0129
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metok_0129
Enzymes [BR:mok01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metok_0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A LdpA_C DUF5461
Motif
Other DBs
NCBI-ProteinID: AEH06125
UniProt: F8AKW5
Position
complement(125244..126329)
Genome map
AA seq 361 aa AA seqDB search
MKLHEYEAKEIFKKYKIPVPEGFITSNEIEKLNKPVVIKAQVLVGGRGKAGGVLFADTVN
EANEKIKELLNKDIKGEKVEKVLVEEKLPIKKEYYLGITIDRAERKPVIMFSTEGGVEIE
EIAKTNPEKIIKYHVNPLNEFLPYIARNILKDADIPSSEISKVADIVYKLYNVFKDMDGM
LVEINPLVITEDGRALAADAVLNVDDDAYYRHDYTQFEEFNKKDKLEFAYVELDGDIGVI
GNGAGLTLASMDMIKEYGGNPACFLDIGGGANEETVKKALEKVLKKDVKGIFINVLAGIT
RCDEVARGIVEVLKKHPNVKFAVRMMGTNEEEGRRILTENGIPFEYSMEKAAKKLMEMVN
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattacacgaatatgaggcaaaggaaatatttaaaaaatacaaaatacctgttcca
gagggatttataacatcaaatgaaatcgaaaaactaaataaacccgttgtaataaaggca
caggttcttgtaggtggaagagggaaagcaggaggggttttatttgcagatactgtgaat
gaggctaatgagaaaattaaagaattgttaaataaagatataaaaggagaaaaggttgaa
aaagttcttgttgaggagaagctccctattaaaaaagaatattatttgggtataacaata
gatagagcagagagaaagccagtaattatgttttcaacagaaggtggtgtagaaatagaa
gaaatcgcaaaaacaaaccctgaaaagataataaaatatcatgttaatccactaaatgaa
tttttaccatatattgcaaggaatatcctaaaagatgccgatataccttcaagtgaaatc
tccaaggttgcagatatagtttataaattatacaatgtatttaaagatatggatggaatg
cttgtggagataaatcctcttgtaataaccgaagatggcagagctcttgcagctgatgca
gttttaaatgtggatgatgatgcatattataggcatgattatacacaatttgaagaattc
aataaaaaagataaacttgaatttgcctatgtggagctcgacggagatattggagtaata
ggtaacggtgcaggtcttactcttgcaagtatggatatgataaaagaatacggtggaaat
cccgcatgtttcttggatattggaggaggggctaatgaagaaactgttaaaaaggcactt
gaaaaggtattgaaaaaggatgtaaagggaatattcataaatgtgcttgcaggtattaca
aggtgcgatgaagttgcaaggggtatcgttgaagtattgaagaaacatccaaatgtgaag
tttgccgtaagaatgatgggaacaaatgaggaagagggaaggagaatattaactgaaaac
ggtattccatttgaatattcgatggaaaaagctgctaaaaaattgatggaaatggttaat
aattaa

DBGET integrated database retrieval system