KEGG   Methanothermococcus okinawensis: Metok_0129Help
Entry
Metok_0129        CDS       T01534                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mok  Methanothermococcus okinawensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metok_0129
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metok_0129
   00640 Propanoate metabolism
    Metok_0129
   00660 C5-Branched dibasic acid metabolism
    Metok_0129
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metok_0129
Enzymes [BR:mok01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metok_0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(125244..126329)
Genome map
AA seq 361 aa AA seqDB search
MKLHEYEAKEIFKKYKIPVPEGFITSNEIEKLNKPVVIKAQVLVGGRGKAGGVLFADTVN
EANEKIKELLNKDIKGEKVEKVLVEEKLPIKKEYYLGITIDRAERKPVIMFSTEGGVEIE
EIAKTNPEKIIKYHVNPLNEFLPYIARNILKDADIPSSEISKVADIVYKLYNVFKDMDGM
LVEINPLVITEDGRALAADAVLNVDDDAYYRHDYTQFEEFNKKDKLEFAYVELDGDIGVI
GNGAGLTLASMDMIKEYGGNPACFLDIGGGANEETVKKALEKVLKKDVKGIFINVLAGIT
RCDEVARGIVEVLKKHPNVKFAVRMMGTNEEEGRRILTENGIPFEYSMEKAAKKLMEMVN
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattacacgaatatgaggcaaaggaaatatttaaaaaatacaaaatacctgttcca
gagggatttataacatcaaatgaaatcgaaaaactaaataaacccgttgtaataaaggca
caggttcttgtaggtggaagagggaaagcaggaggggttttatttgcagatactgtgaat
gaggctaatgagaaaattaaagaattgttaaataaagatataaaaggagaaaaggttgaa
aaagttcttgttgaggagaagctccctattaaaaaagaatattatttgggtataacaata
gatagagcagagagaaagccagtaattatgttttcaacagaaggtggtgtagaaatagaa
gaaatcgcaaaaacaaaccctgaaaagataataaaatatcatgttaatccactaaatgaa
tttttaccatatattgcaaggaatatcctaaaagatgccgatataccttcaagtgaaatc
tccaaggttgcagatatagtttataaattatacaatgtatttaaagatatggatggaatg
cttgtggagataaatcctcttgtaataaccgaagatggcagagctcttgcagctgatgca
gttttaaatgtggatgatgatgcatattataggcatgattatacacaatttgaagaattc
aataaaaaagataaacttgaatttgcctatgtggagctcgacggagatattggagtaata
ggtaacggtgcaggtcttactcttgcaagtatggatatgataaaagaatacggtggaaat
cccgcatgtttcttggatattggaggaggggctaatgaagaaactgttaaaaaggcactt
gaaaaggtattgaaaaaggatgtaaagggaatattcataaatgtgcttgcaggtattaca
aggtgcgatgaagttgcaaggggtatcgttgaagtattgaagaaacatccaaatgtgaag
tttgccgtaagaatgatgggaacaaatgaggaagagggaaggagaatattaactgaaaac
ggtattccatttgaatattcgatggaaaaagctgctaaaaaattgatggaaatggttaat
aattaa

DBGET integrated database retrieval system