KEGG   Methanothermococcus okinawensis: Metok_0177Help
Entry
Metok_0177        CDS       T01534                                 

Definition
coenzyme F420 hydrogenase subunit beta (EC:1.12.98.1)
Orthology
K00441  
coenzyme F420 hydrogenase subunit beta [EC:1.12.98.1]
Organism
mok  Methanothermococcus okinawensis
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Metok_0177
Enzymes [BR:mok01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.98  With other, known, acceptors
    1.12.98.1  coenzyme F420 hydrogenase
     Metok_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(176347..177195)
Genome map
AA seq 282 aa AA seqDB search
MDAFGNYKTIISARATDKKILKKSQDGGIVSSAFIYGLENNLLDGVIVADKGEGCKPVPK
VATTPEEVLKAGGTKYTVCPNISVLKSAIREYGCEKLGVVGTPCQVIATRKAMKYPVGFR
HMPDKIALIMGIFCMENFPYNGMKTIIEEHCGVKIDDVAKLDIGKGKFWVYTKWGEAKSI
KLKETHPYEQKACHVCTDYTAELADISTGSVGSPDGWSSVFIRTSKGEEFFNKMVDEGYL
ETKPIDEGKFGLGILEKLALTKKTNNSKEIEHRKEIGLPVPY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttttggaaattataagacaataatatccgcaagagctacggataaaaagata
ttaaaaaaatcccaagatggtgggatagtatctagcgcatttatatatgggttggaaaat
aaccttttagatggtgtaatagtagcagataaaggtgaaggttgtaagccagttcccaag
gttgccacaacaccagaagaggttttaaaagcaggaggaacaaaatatacagtatgtcca
aatataagcgttttaaaaagtgctattagagaatacggctgtgaaaaacttggagttgta
ggaactccatgtcaggtaatagctacaagaaaagccatgaaatatccagtaggattcaga
cacatgccagataaaattgcattgattatgggtatattctgtatggaaaacttcccatat
aatggtatgaaaaccataattgaagaacactgcggtgtaaaaatagacgatgttgctaaa
ttggatataggaaaaggtaaattctgggtatatacaaaatggggagaggcaaaatctata
aagttaaaagaaacccatccctacgaacaaaaagcatgccatgtatgcacagactataca
gcagaattggcagatatctcaacaggttcagtaggcagtcctgatggttggagctcggta
tttataagaacatcaaaaggtgaagaattcttcaacaagatggttgatgaaggatactta
gaaaccaaaccaatagatgaaggtaaatttggtttaggaatccttgaaaaacttgcatta
actaagaaaactaataattccaaagaaattgaacatagaaaagagataggattacctgtt
ccttattaa

DBGET integrated database retrieval system