KEGG   Methanothermococcus okinawensis: Metok_0177Help
Entry
Metok_0177        CDS       T01534                                 

Definition
coenzyme F420 hydrogenase subunit beta (EC:1.12.98.1)
Orthology
K00441  
coenzyme F420 hydrogenase subunit beta [EC:1.12.98.1]
Organism
mok  Methanothermococcus okinawensis
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mok00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(176347..177195)
Genome map
AA seq 282 aa AA seqDB search
MDAFGNYKTIISARATDKKILKKSQDGGIVSSAFIYGLENNLLDGVIVADKGEGCKPVPK
VATTPEEVLKAGGTKYTVCPNISVLKSAIREYGCEKLGVVGTPCQVIATRKAMKYPVGFR
HMPDKIALIMGIFCMENFPYNGMKTIIEEHCGVKIDDVAKLDIGKGKFWVYTKWGEAKSI
KLKETHPYEQKACHVCTDYTAELADISTGSVGSPDGWSSVFIRTSKGEEFFNKMVDEGYL
ETKPIDEGKFGLGILEKLALTKKTNNSKEIEHRKEIGLPVPY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttttggaaattataagacaataatatccgcaagagctacggataaaaagata
ttaaaaaaatcccaagatggtgggatagtatctagcgcatttatatatgggttggaaaat
aaccttttagatggtgtaatagtagcagataaaggtgaaggttgtaagccagttcccaag
gttgccacaacaccagaagaggttttaaaagcaggaggaacaaaatatacagtatgtcca
aatataagcgttttaaaaagtgctattagagaatacggctgtgaaaaacttggagttgta
ggaactccatgtcaggtaatagctacaagaaaagccatgaaatatccagtaggattcaga
cacatgccagataaaattgcattgattatgggtatattctgtatggaaaacttcccatat
aatggtatgaaaaccataattgaagaacactgcggtgtaaaaatagacgatgttgctaaa
ttggatataggaaaaggtaaattctgggtatatacaaaatggggagaggcaaaatctata
aagttaaaagaaacccatccctacgaacaaaaagcatgccatgtatgcacagactataca
gcagaattggcagatatctcaacaggttcagtaggcagtcctgatggttggagctcggta
tttataagaacatcaaaaggtgaagaattcttcaacaagatggttgatgaaggatactta
gaaaccaaaccaatagatgaaggtaaatttggtttaggaatccttgaaaaacttgcatta
actaagaaaactaataattccaaagaaattgaacatagaaaagagataggattacctgtt
ccttattaa

DBGET integrated database retrieval system