KEGG   Methanothermococcus okinawensis: Metok_0227Help
Entry
Metok_0227        CDS       T01534                                 

Definition
histone acetyltransferase, ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mok  Methanothermococcus okinawensis
Brite
Enzymes [BR:mok01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Metok_0227
Transfer RNA biogenesis [BR:mok03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Metok_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
242463..244121
Genome map
AA seq 552 aa AA seqDB search
MNGFNKNALDDSTYKKFIRCIIDKLLANKNNLNALPPKRKKQKVEDIKAQCLRKFNLNIG
FPPNSEIIKYATDEEKKDIIPIIRKKPIRTLSGVAVVAVMTSPEKCPHGKCLFCPGGTES
TFGDVPQSYTGREPATMRGLMYKFDPYTQTKERIEQLEKVGHPTDKIELIIMGGTFPARP
TEYQDNFIKGCFDAMNGTISETLEEAQKINETAKHRCVALTVETRPDYCKENEINQMLKL
GTTRVELGVQTIYNDILYYVKRGHTVEDSIKATQLLKDSGLKVSYHIMPGLPKSSKELDK
KVFYEIFNNPDFKPDLIKIYPCLVIKGTELYDLWKKGEFKPITDEEAVELITYAKSIMPK
WVRTSRIQRDIPATVIEEGVKKSNLGELVYKNLDKKGIKCKCIRCREVGHVMYKKGIVPD
INYIKLCREDYIASGGKEIFLSYEDVKNDILIGYLRLRIPYKPFRPEIDDKTALVRQLHV
CGQEQKLTEKEDKENSWQHRGYGRLLLKEAERIAKEEFDKNKLLITSGIGVREYYRKLGY
KRVGAYMGKDLI
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaatggattcaataaaaatgccctcgatgattccacatataaaaaatttataagatgc
ataattgataaattacttgcaaataaaaataatttgaacgcattacccccaaaaagaaaa
aaacaaaaggttgaggatattaaagcacaatgtttaaggaaatttaacttaaatataggt
tttccccctaattctgaaataataaaatatgcaacagatgaggagaaaaaggatattatt
ccgattattagaaaaaaacctattagaacattatctggggtagctgttgtggctgtaatg
acctctcctgagaaatgcccccatggaaaatgtttattctgtccaggaggaactgaaagc
acttttggagatgttcctcagagttatacaggtagagaacctgccacaatgagaggtctt
atgtataaatttgacccttacactcagacaaaagaacgaatagagcaacttgaaaaggtg
ggacatccaacagataagatagaactgattataatggggggaacatttcctgcaagacct
actgaataccaggataattttataaaaggatgcttcgatgctatgaatggtacaatatct
gaaacacttgaagaggcacaaaaaataaatgaaactgcaaaacatagatgcgtagctctt
acagttgaaactagaccagactactgcaaggaaaatgagataaatcaaatgcttaaattg
ggaaccacaagggtagagctcggtgttcaaacgatatataacgatatattatactatgta
aaaagagggcatactgttgaggatagcataaaagcaacgcaattattaaaggatagcggt
ttaaaggtatcatatcatattatgcctggacttccaaaatcatcaaaggaacttgataaa
aaggtattttatgaaatatttaataatccagatttcaaaccagatttaataaaaatatat
ccatgtttggtaataaaaggaaccgagctatatgatttatggaaaaaaggggaatttaaa
ccaataaccgatgaggaagccgtagagctcataacctatgcaaaatccataatgccaaaa
tgggtgagaacttcaagaatacagagggatatacctgcaacagtaattgaagaaggtgtt
aaaaaaagtaatttaggtgaattggtatataaaaacctcgataaaaagggcataaaatgc
aagtgtataagatgtagggaagtaggtcatgtaatgtataaaaagggaatagttcccgat
attaactatataaaattatgtagggaggattatattgcaagtggcggaaaagagatattc
ctatcttatgaagatgttaaaaatgatatacttattgggtatttaagattaaggataccg
tataaaccatttagaccagagatagacgataaaactgcacttgttagacagttgcatgta
tgcggtcaagagcaaaaattaaccgaaaaagaagataaagaaaattcatggcaacataga
ggatatggaagattattactaaaagaggctgaaaggatagcaaaagaggaatttgataag
aataaactgctaattacaagtggtattggcgtaagggaatattatagaaagttgggttat
aagcgagttggggcttatatgggtaaagatttaatataa

DBGET integrated database retrieval system