KEGG   Methanothermococcus okinawensis: Metok_0528Help
Entry
Metok_0528        CDS       T01534                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mok  Methanothermococcus okinawensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metok_0528
Enzymes [BR:mok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Metok_0528
Exosome [BR:mok04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Metok_0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532383..533357
Genome map
AA seq 324 aa AA seqDB search
MIIRPRRLRANQKIRDLVRETVLTKNDLIMPLFIDENLNAGDKKEIPSMPNQYRFSIDGV
VEECKEIADLGIPAVILFGIPRYKDEIASSAYDKNGVIQKSIRKIKDELGDELLIIADTC
LCEYTSHGHCGLIKDNKVLNDETLEILSKIALSYAESGVDVVAPSDMMDGRVGRIRSVLE
ENDYKDVAIMSYAAKYASSFYGPFRDAAESSPKSSIKDRKTYQMDYGNSREALREIELDI
NEGADMVLVKPALPYLDILKMAKENFNVPVGGYCVSGEYSMIEAAAQNGWLNREEAIMEA
LYCIKRAGADFIITYWAKEVANLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgataatacgaccaagaagattaagagcaaatcaaaaaataagagatttagttagagaa
acggttttaacaaaaaacgatttaataatgcctctttttattgatgaaaacctaaatgca
ggagataaaaaagaaattccttcaatgccaaatcaatataggtttagtatagatggtgtt
gttgaagaatgtaaagagatagcagatttaggcattcctgcggtaatattatttgggatt
ccacgatacaaagatgaaattgcatcctcggcatacgataaaaatggagtaattcaaaaa
tccataagaaagataaaagatgagctcggggatgagctcctaattatagccgatacctgt
ttatgtgaatatacttcccatgggcattgcggtttaattaaagataacaaggttttaaat
gatgaaacccttgaaatactttcaaagatagccttatcctatgctgagagtggagttgat
gtagttgctccatcggatatgatggatggaagagttgggaggataagaagtgttttagag
gaaaatgattataaagatgtagctattatgagttatgctgcaaaatatgcttcctcattt
tatggaccatttagggatgccgcagagagctcacctaaatcatccataaaagataggaaa
acctaccaaatggattatggaaattcaagggaggctctgagagaaattgaattggatatt
aatgaaggagcagacatggtattggtaaaacctgcacttccttatttggatattttaaag
atggctaaggaaaacttcaatgtgccagttggaggatactgtgtaagtggagaatattct
atgattgaggctgctgctcaaaatggatggttaaacagagaagaagcaattatggaagca
ctatactgtataaaaagagcaggagcagatttcataattacatattgggcaaaagaagtt
gctaatttattgtaa

DBGET integrated database retrieval system