KEGG   Methanothermococcus okinawensis: Metok_0676Help
Entry
Metok_0676        CDS       T01534                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mok  Methanothermococcus okinawensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mok00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mok00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
684376..685287
Genome map
AA seq 303 aa AA seqDB search
MKMKHLISIKDIGKKEILKILDESEKMEELLKSKKVIDILNGKILATLFYEPSTRTRLSF
ETAMKRLGGNVIGFTDIKNTSVMKGESLADTIRVISGYADIIAIRHPSEGSARLASEYAT
IPVINAGDGSNQHPTQTLLDLYTIKREIGKIDGIKIAFVGDLKYGRTVHSLCYALSLFDD
VEIVFISPEELKIPREIIEDLNKKENIKYSEKSNIDLTGIDVVYMTRIQKERFPDLNEYQ
KVKGIYKLTRELIYNKNLIVMHPLPRVDEIDSNVDELPQAKYFKQSFYGVPVRMAILKML
LEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaagcatttgatatctataaaagatataggaaaaaaagaaattttaaagata
ttggatgaatcggaaaaaatggaagaattattaaaatccaaaaaagtaatagatattttg
aatggaaaaatacttgctacattattttacgaaccatccacacgaacaaggttatccttt
gaaactgctatgaagagacttgggggaaatgtgataggatttacagatataaaaaatacc
tctgttatgaaaggagaaagtttggcggatacaatacgggttattagtggatatgccgat
ataatagccataagacacccatcagaaggttctgcaagattagcaagtgaatatgcaaca
attcctgtaataaatgcaggagatggttcaaaccaacaccccacgcaaacattgcttgat
ttatataccataaaaagagaaataggaaagatagacggaataaagattgcatttgttggg
gatttaaaatatggaagaacagttcattctttatgctatgccctgtccttatttgatgat
gtagaaatagtattcatttcaccagaagaacttaaaataccaagagaaataattgaagat
ttgaataaaaaagaaaatattaaatattctgaaaaatccaatatagacttaacaggtatt
gatgttgtatatatgacaagaattcaaaaggaaaggtttccagatttaaatgaatatcaa
aaggtaaagggaatatacaaacttacaagagagctcatatataataaaaatttaattgtt
atgcatcccctcccaagagttgatgaaatagattcaaatgtggatgagctcccgcaggct
aaatattttaagcaatctttttatggtgttcctgttagaatggcaatattaaagatgctt
ttggaaaaataa

DBGET integrated database retrieval system