KEGG   Methanothermococcus okinawensis: Metok_0867Help
Entry
Metok_0867        CDS       T01534                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
  KO
K00204  4Fe-4S ferredoxin
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00680  Methane metabolism
mok01100  Metabolic pathways
mok01120  Microbial metabolism in diverse environments
mok01200  Carbon metabolism
Module
mok_M00567  Methanogenesis, CO2 => methane
mok_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Metok_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_6 Fer4 Fer4_10 Fer4_7 Fer4_2 Fer4_9 Fer4_21 Fer4_16 HTH_3 Fer4_22 Fer4_15 HTH_5 HTH_19 Fer4_17 HTH_38 DUF2096 Fer4_4 Fer4_3 Fer4_8 HTH_23 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AEH06840
UniProt: F8AME5
Position
888547..889011
Genome map
AA seq 154 aa AA seqDB search
MPEHILSGIKAIVAMKLKKEGKLQREIAEYLKMDRSIISHYLHGRHPSDRVMRVSEEIVD
LPAEYGIRIINSMSEDRELTKKIIDNLYHVKIEIDRNKCILCGECLECPYNAIFKNGHLI
EIDNNKCMLCGDCIAICPVNALKLNKFLPNELEE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacatatattatcagggattaaagcaatagtggcaatgaaactaaaaaaggaa
ggaaaattgcagagagagatagcagagtatctaaaaatggataggtcaataatttctcat
tatttacatggaagacacccatcagatagagttatgagagtttcagaagagatagtggat
ttaccagcggaatacggcattaggattataaattcaatgagtgaagatagagagcttaca
aagaaaattatagataatctatatcatgtaaaaattgaaatagataggaataaatgtatt
ctctgcggagaatgtctcgaatgtccttataatgctatttttaagaatgggcatttaata
gaaatagataataacaaatgcatgttatgtggagactgcatagctatttgcccagtaaat
gctttaaaattaaataaattcttaccaaatgaattggaggaataa

DBGET integrated database retrieval system