KEGG   Methanothermococcus okinawensis: Metok_0942Help
Entry
Metok_0942        CDS       T01534                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00010  Glycolysis / Gluconeogenesis
mok00020  Citrate cycle (TCA cycle)
mok00620  Pyruvate metabolism
mok00633  Nitrotoluene degradation
mok00640  Propanoate metabolism
mok00650  Butanoate metabolism
mok00680  Methane metabolism
mok00720  Carbon fixation pathways in prokaryotes
mok01100  Metabolic pathways
mok01120  Microbial metabolism in diverse environments
mok01130  Biosynthesis of antibiotics
mok01200  Carbon metabolism
Module
mok_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mok_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metok_0942
   00020 Citrate cycle (TCA cycle)
    Metok_0942
   00620 Pyruvate metabolism
    Metok_0942
   00640 Propanoate metabolism
    Metok_0942
   00650 Butanoate metabolism
    Metok_0942
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metok_0942
   00680 Methane metabolism
    Metok_0942
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metok_0942
Enzymes [BR:mok01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metok_0942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_16 Fer4_17 Fer4_8 Fer4_13 Fer4_15 CH_2 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AEH06912
UniProt: F8AMT1
Position
complement(964890..965147)
Genome map
AA seq 85 aa AA seqDB search
MVTIGAIIYEPGNSINNKTGSWRVFKPIMDKDKCVMCENCFIFCPEGCIKEKDGKFEIDY
DYCKGCLICVEECPVNAITSIREEK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggttactattggagccataatatacgaaccaggtaattccattaataacaaaacaggt
agttggagagtattcaagcctataatggataaagataagtgcgtaatgtgtgaaaattgt
tttatattttgtccagaagggtgtatcaaagaaaaagatggaaaatttgaaatagactat
gattactgcaaaggatgccttatatgtgtagaagaatgtccagttaatgcaataaccagt
attagggaagaaaaataa

DBGET integrated database retrieval system