KEGG   Methanothermococcus okinawensis: Metok_1010Help
Entry
Metok_1010        CDS       T01534                                 

Definition
RimK family alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mok  Methanothermococcus okinawensis
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Metok_1010
Enzymes [BR:mok01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Metok_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1031121..1031990
Genome map
AA seq 289 aa AA seqDB search
MKMGIISEEKDWITCELERAMIKKDITPIYIKPSKIASFTGMDIKFKHNKENIMDLKCAF
VRNLGNVSNYYRFDVLKYIEYYIPLINPTEGLENAGNKYRTSILLNINNISHPKTVITED
IDKALIWSEKLNDCVLKPLFGNQGKGIVRLNNKNLISKINILNEFKKKYGVFYIQEFINN
PNNIYRDIRAFVIGDEVVSAMYRVSDNWITNIHQNGKAEKCELTDEIIELAVKAKNATGL
VYGGVDLMESSDGLKVIEVNGAPSWEGLSRVSDVNITEKLIDYVLNNLI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgggaataatatcagaagaaaaagattggattacctgcgaattagaaagggcg
atgataaaaaaggatataacccccatatatattaaaccatccaaaattgcttcttttaca
ggaatggatattaaatttaagcataacaaagaaaatatcatggatttaaaatgtgcattt
gttagaaacctcggtaatgtatccaattattatagattcgatgttctcaaatatatagaa
tattatattccattaataaatccaacagaaggacttgaaaatgcaggtaataaatataga
acttccatactgctaaatataaataatatatctcacccaaaaacagttattacagaggat
attgataaggcattaatatggtcagaaaagttaaatgattgtgttttaaaaccattattt
ggaaatcaagggaagggcattgttagattaaataataaaaatctaatttctaagataaat
atattaaacgaatttaaaaagaaatatggtgtattttatatccaagaatttataaataat
ccaaataatatttatagggatattagggcttttgttattggagatgaagtagtatctgca
atgtatagagtttctgacaattggataacaaatattcaccaaaatggaaaggcagaaaaa
tgtgagctcaccgatgaaataatagagctcgcagttaaagcaaaaaatgcaactggattg
gtatatggtggagtggatttaatggaaagtagtgatggtttgaaggtaattgaagttaat
ggagctccttcatgggaaggactttcaagggtttcagatgtaaatataactgagaaatta
atagattatgttttaaataatttaatttaa

DBGET integrated database retrieval system