KEGG   Methanothermococcus okinawensis: Metok_1022Help
Entry
Metok_1022        CDS       T01534                                 

Definition
inorganic polyphosphate/ATP-NAD kinase (EC:2.7.1.23 3.1.3.25)
Orthology
K00858  
NAD+ kinase [EC:2.7.1.23]
Organism
mok  Methanothermococcus okinawensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mok00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1043306..1045270)
Genome map
AA seq 654 aa AA seqDB search
MLDIVIKVAENIEKGVKPLIGWEKSDEIVKIGADGTPTKKIDLIAENIAIKSIEKYCSAL
LVSEEIGFKKIGKGIPEYVIVLDPIDGTFNALNDIPIYSVSIAMGHLKKSACNNIKNDYD
ENDKNDDFYENLLSGMTINDLEVGVVNNIATGDIYCAKVNEGAYIIESPNREKRKINVSN
IKNLKDASVGVFAYGLTTNTLDFIKDRMVKRIRIFGSAALEMCYVARGALDAFINVNKTT
RLCDIAGGYVILRESGGIITDKDGKIIDMGLNVYEKTSLICSNNALHKKFVGIFGNKWML
KPTKFGIISRIDRRDALNLVLDVIKYLDSKHIKYALEPSLCEIINNFNNNCDNKDINSNN
NNQNNMSKDIGNNNIDNDNMDNKNNITSNNNKPIEYEPMTDLNDISHIISIGGDGTVLRA
SRVINGNEIPIIPINMGTVGFLTEFNKNKVFEAIDKIVNGNYEIEKRTKCAGLIKHADYS
LSSGCEDKDNKNNFNNSHNYNNFQKILPDALNEVVIITKSPAKMLHFEVYVNGNFVEDVR
ADGLIVSTPTGSTAYSLSAGGPILEPSVDAFVIVPICPFKLFSRPIVIDGNSEIKIKVLK
KSTLVVVDGNIEDEAKKGDEIILRKSNSYSYFVKGCNFYNKLRKLSIIGKRDEC
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatatagttataaaagtggctgaaaatattgaaaaaggggtaaaaccattaatt
ggatgggagaaatccgatgagattgtaaagattggggcagatgggactccaactaaaaaa
atagacttaatagcagaaaacatagctataaaatctattgaaaaatattgcagtgcactg
cttgtaagtgaagaaataggttttaaaaagataggaaagggcattccagaatatgtcatt
gtcttagaccccatcgatggaacattcaatgccttaaacgatataccgatatattcagtt
tcaatagccatggggcatttgaaaaaatcagcttgcaataatatcaaaaatgattatgat
gaaaatgataagaatgatgatttttatgaaaatctgttaagtggtatgactattaatgat
ttagaagtaggagtagtaaataatatagcaacgggggatatttattgtgcaaaagttaat
gaaggagcatatatcatagaaagtcccaatagagaaaaaaggaaaataaatgtttcaaat
ataaaaaatctgaaagatgcctctgttggagtttttgcctatggtttaacaacaaatacg
cttgattttataaaggatagaatggtaaaaaggataagaatttttggttccgcagcattg
gaaatgtgctatgtagcaaggggggctttagacgcattcataaatgtaaataaaactacg
agattatgcgatattgcaggaggttatgtgattcttagggaatctgggggtataatcaca
gataaagatggaaaaataatcgatatgggattaaatgtatatgaaaaaacatcgcttata
tgctcaaataatgcccttcataaaaaatttgttggaatatttggaaataaatggatgctt
aaaccaacaaaatttggcattatttcaaggattgacagaagagatgcccttaatttagtc
ctagatgttataaaatatttggattcaaaacatattaagtatgcactggaaccttcacta
tgcgagattatcaataatttcaacaataactgcgataacaaagatattaacagcaataac
aataaccagaacaacatgagcaaggatataggtaataataatatagataatgataatatg
gataataaaaataatattactagtaataataacaaacccattgaatacgaacctatgact
gatttaaatgatatatcccatataatatctattggtggagatggaacagttttaagggct
tcacgagttataaatggtaatgagataccaataattccaataaatatgggtacagtaggt
tttttaacggaatttaataaaaataaagtatttgaagcaatagataagattgtaaatgga
aactatgaaattgaaaagagaacaaaatgtgcaggattgattaaacatgcagattactct
ttaagtagcggttgtgaagataaagataataaaaataattttaataactcacataattat
aataatttccaaaaaatacttcctgatgccttaaatgaagtggttataataacaaaaagt
cctgcaaagatgcttcactttgaggtgtatgtaaatggaaactttgtagaggatgttagg
gcagatggtcttattgtatccacaccaacaggttcaacggcatattcattgagtgcaggc
ggtccaattttagagccttcggttgatgcatttgtaattgttccaatatgcccatttaaa
ttgttttctcgcccaatagttattgatggaaactcagaaattaaaataaaagtattaaaa
aaatccacacttgttgtagtggatggaaatattgaggatgaggctaaaaaaggagatgaa
ataattttaagaaaatccaattcctactcctattttgttaaaggatgcaatttctacaac
aaattgagaaaacttagtattattggaaaaagggatgaatgttaa

DBGET integrated database retrieval system