KEGG   Methanothermococcus okinawensis: Metok_1121Help
Entry
Metok_1121        CDS       T01534                                 

Definition
(GenBank) deoxyribose-phosphate aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00010  Glycolysis / Gluconeogenesis
mok00030  Pentose phosphate pathway
mok00051  Fructose and mannose metabolism
mok00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mok00680  Methane metabolism
mok01100  Metabolic pathways
mok01110  Biosynthesis of secondary metabolites
mok01120  Microbial metabolism in diverse environments
mok01130  Biosynthesis of antibiotics
mok01200  Carbon metabolism
mok01230  Biosynthesis of amino acids
Module
mok_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metok_1121
   00030 Pentose phosphate pathway
    Metok_1121
   00051 Fructose and mannose metabolism
    Metok_1121
  Energy metabolism
   00680 Methane metabolism
    Metok_1121
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metok_1121
Enzymes [BR:mok01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Metok_1121
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Metok_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: AEH07090
UniProt: F8ANU9
Position
1138325..1139245
Genome map
AA seq 306 aa AA seqDB search
MKDVKILKKDVLVPADIPANKKEEYIKNYLELTKNTGRLMLFAGDQKIEHLNDDFYGEGI
SKDDATPEHFFKVASNSKIGAFATQLGLIARYGVDYRDINYIVKINSKTNLVKTSQRDPI
SKSLIDVADVVEFKNNSGLNILGVGYTIYLGSEFEHEMLSEASRVVYEAHKNGLIAILWI
YPRGKAVKNEKDPHLIAGATGVGACLGADFVKVNYPECENPAEAFKEAVLAAGRTKVVCA
GGSSTDPKLFLQRLYDQIHISGAAGNATGRNIHQKSYEEAVRMCNAIYAITIENKSVDEA
LKIYYG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgttaaaatattgaaaaaagatgtgctggttccagcagatattccagcaaat
aaaaaggaggaatatataaaaaattaccttgaattaacaaaaaataccggtaggctaatg
ctttttgcaggagaccaaaaaatagaacatttaaatgatgatttttatggtgaagggata
tcaaaggatgatgccacacctgaacatttctttaaagtagcttcaaattcaaaaataggg
gcctttgctacacagttaggattaatagcaagatacggcgtagattatagggatataaat
tatatagttaaaataaattcaaaaacaaatcttgttaaaacctctcaaagagacccaata
agtaaatcgttgatagatgtagctgatgttgtagagtttaagaataattctggcttaaat
atacttggagtaggttatacaatatatttgggaagcgagtttgaacatgaaatgctctca
gaggcatcaagggtagtatatgaggcacacaaaaatggattaattgcaatattgtggata
tatccaagaggaaaggcagttaaaaacgaaaaagacccacatttaatagcaggagctacg
ggcgttggagcatgtttaggggcagattttgttaaagtaaattatcctgaatgtgaaaat
ccagccgaagcatttaaagaggcggttttagccgcaggtagaacaaaggttgtatgtgca
ggtgggagctccacagacccaaaactatttttgcagagactctatgaccaaatacatata
agtggtgcagcaggaaatgccacaggcaggaatatacaccaaaaatcctacgaagaagct
gtaaggatgtgtaatgcaatatatgctattactattgaaaataaaagcgttgatgaagct
ttaaaaatatattatggataa

DBGET integrated database retrieval system