KEGG   Methanothermococcus okinawensis: Metok_1169Help
Entry
Metok_1169        CDS       T01534                                 

Definition
(GenBank) von Willebrand factor type A
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00860  Porphyrin and chlorophyll metabolism
mok01100  Metabolic pathways
mok01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metok_1169
Enzymes [BR:mok01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Metok_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA_CoxE DUF1910
Motif
Other DBs
NCBI-ProteinID: AEH07137
UniProt: F8ANZ4
Position
1189136..1190137
Genome map
AA seq 333 aa AA seqDB search
MHDDNKDKEDKKDNPNENDNNQNTNNNSNNDNNSNNNNDKDNDSNNKNNKDSNAQEQMFN
AKGGINPNIIKIQLKDNISRYSSGRHVKSISKKGRYIKYRIPNGKTTDIAFDATLRASAL
YQKDRKEKSDNKNVALYLKKEDLREKIRERKISTNILFSVDASGSMGAMKRMEAAKGAVV
SLLMDAYQKRNKVSMITFRKDSAELLLPFTSSVELAEKCLSETPTGGKTPLSKAFLKSYE
VIKNNMRKNPNIIPIVVFISDFKPNVAMEKDYIKEVYDICEKFAEDEINVILIDTEPKSF
IKIGIGENIAKKYGFKYYKIDDLSSENILNALN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgacgataataaagataaagaagataaaaaggacaatcccaatgaaaacgataat
aaccaaaataccaataataatagcaataacgataataatagtaacaataataacgataaa
gataatgatagtaataataaaaataataaagacagcaacgctcaggaacagatgtttaat
gccaaaggaggtataaacccaaatataataaaaatacaactaaaagataatataagtagg
tattcaagcggaaggcatgttaaaagtataagtaaaaaaggtagatacataaaatacagg
attccaaatggaaaaacgaccgatatagcatttgatgccacactaagggcaagtgcattg
tatcaaaaggatagaaaagaaaaatccgataataaaaatgtggcattgtatcttaaaaag
gaagatttaagggaaaaaataagggaaagaaaaatttcaacaaatatactttttagtgtg
gatgcaagcggttctatgggggctatgaaaagaatggaagctgcaaaaggggctgtggta
tccttattaatggatgcatatcaaaagagaaataaggtatctatgattacatttagaaaa
gatagtgcggagctcctattaccattcacatcatctgtcgagctcgcagagaaatgttta
agtgaaaccccaacaggcggtaaaactcctctttcaaaggcatttttaaaatcttatgaa
gtgattaaaaacaacatgagaaaaaatccaaatatcattccaatagttgtatttataagt
gattttaagccaaatgtagccatggaaaaagattatataaaagaagtatatgatatctgt
gaaaaatttgcagaagatgaaataaatgtaatactaatagatactgaaccaaaatcattt
ataaaaataggtattggagaaaatattgctaaaaaatatggatttaaatattataaaatt
gatgatttatcctccgaaaatatattaaatgcccttaattaa

DBGET integrated database retrieval system